CAZyme Information: MGYG000000815_00112

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_00112
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000000815_1|CGC2	75874.25	6.5064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 133359; End: 135386 Strand: -

Full Sequence      

MKYKLLIIIFLCINSLQYLSAQESQQGWIIEAKNTQNYTGAPTANGTIGILPWKEPFSIR
HVILNHVFDISDEYGVTRVLKGINPFILKMSINGEQVTESNISGWKQSINMKEATHTTSF
KVGKTAEIEYTISALRNLPFSGLINITVNALDNISLNIENEMDIPKEYVGANHVFKSLNA
GGKQVSILQVNASSEKHMQKVAASSVFIYPTDRFQLDNKEKKQTSISGNMKKGEKISFSL
AGSICSTRDFVDPSSESERQVIYIMHEGIPSIMEAHKRHWADLWQGDIIIEGDDEAQKTV
RFALFNLYAYCRAGSDLSISPMGLSSQGYNGHIFWDSEIWMFPPMLFLNQGIAESMINYR
INRLAAAERKADAYGYKGAMFPWESDDFGEESTPIYSTTGQFEHHITADIAIACWNYYCM
NKDLKWLKEKGYPLMKKAADFWVSRVEKNTDGTYSIKNVVGADEYAEGKTDNAFTNGAAI
KALDFAAQAAKICGEEAPEEWVDISKNISIHTFENGVTKEYIDYDGQIIKQADANLLGYP
LNIITDTIRLRKDLEYYEHKVDNVHGPAMTYSIFCVQYAHLGDIDKATEMFYRCYQPNVR
PPFNVLAETATSQNPYFATCAGGLLQAVINGFGGLEVTPSGIIQKKSVLPKHWKKLSIKG
VGKDRKTYTVTNYKY

Enzyme Prediction     

No EC number prediction in MGYG000000815_00112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	301	638	1.3e-98	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	1.13e-97	28	657	11	719	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	3.41e-65	301	637	1	382	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	2.83e-36	78	665	80	716	maltose phosphorylase; Provisional
pfam17389	Bac_rhamnosid6H	0.003	410	508	103	205	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3387	SGA1	0.005	372	591	318	560	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT91743.1	1.25e-291	38	668	38	670
QRQ48989.1	3.99e-280	5	668	8	667
QIU93251.1	5.70e-277	4	668	2	665
QUT79346.1	7.92e-272	6	668	4	664
QDM10252.1	7.92e-272	6	668	4	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.56e-197	25	672	21	678	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	4.05e-51	24	656	4	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	1.48e-31	78	665	80	718	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	1.51e-30	229	663	228	716	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	2.00e-30	218	663	217	716	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	5.27e-78	13	670	3	659	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	3.81e-59	255	659	279	735	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
A0JMP0	1.52e-57	275	661	185	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
F1NZI4	4.28e-57	249	662	209	638	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8RBL8	3.57e-53	258	659	279	732	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999104	0.000175	0.000158	0.000140	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_00112.