CAZyme Information: MGYG000000815_00140

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_00140
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000000815_1|CGC3	91150.29	6.3512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 181891; End: 184308 Strand: -

Full Sequence      

MKKLRLCLLLALLPIISAAAHTHHEQQTTQKDYPIQPVSFVSVKFSDKFWAPRIKTNQDV
TIPIALKQCYITGRVDNFKKAGGLMPGYFDTQFTFDDTDIYKILEGMSYSIQMYPNKDLE
ARMDTLIYYIQKAQEPDGYLFTARTAAEPGKLHEWVGAKRWEKDPDLSHELYNCGHLYEA
AVAHYQATGKRTLLDVAIKNADLLVKDFGPGKLAYEPGHQIVEMGLVKMYRVTGKKEYLD
LAKYFLDLRGHGESGEYSQTHKPVIEQDEAVGHAVRAAYMYSGMADVAALTGNSAYLHAI
DNIWDNVVTKKYYITGGIGATGHGEAFGKNYELPNMSAYCETCAAIANVYWNHRLFLLHG
DSKYYDVLERTLYNGLISGISLSGDHFFYPNPLESVGQHGRSEWFGCACCPSNVCRFMPS
IPGYVYAKKDNKIYVNLFIESESDIELNKNDIKIAQKTGYPWDGNVSITIDPKKAETFEV
LVRVPGWVQNQPVPSDLYSYLNPKKETVKIKVNGVETDNTVSPNGYIAISRKWKKGDNIV
VDFPMDVHRTLANDKVEDDRGKVSLERGPIVYCLEWPDNQDKVLNAVLEDNVPITASFIP
DELNGIVRLEADAKSARRGDDNEVIIENKHLTAIPYYAWANRGAGEMAVWIPRTKERTRP
LPPPTICTSAKVTSSAPNKSLSSVNDGYWPDNSNDRHVPFYSLWPKNNSEEWVTYEFDKP
ETFSSAFVYWYDDAPWGGCRIPLSWKVQYQDANGQWLDVKTKGSYKSEKDVKNQIEFEPV
SAKFVRLSVQLPVKESIGIYEFEVK

Enzyme Prediction     

No EC number prediction in MGYG000000815_00140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	43	573	2.2e-204	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	42	573	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.40e-170	49	655	22	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam00754	F5_F8_type_C	9.06e-05	682	790	5	113	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd04791	LanC_SerThrkinase	1.22e-04	162	327	75	255	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
pfam17132	Glyco_hydro_106	0.002	668	787	172	282	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTR49456.1	0.0	26	805	25	807
QIH34670.1	0.0	5	805	3	807
ARK12764.1	0.0	6	804	9	801
AEI51347.1	0.0	26	805	27	803
AXE17344.1	0.0	32	805	27	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.20e-255	33	652	5	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.17e-148	42	651	15	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.45e-144	42	651	15	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.02e-108	1	652	1	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.01e-101	75	650	54	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.55e-101	75	650	54	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001727	0.984428	0.012969	0.000281	0.000277	0.000273

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_00140.