CAZyme Information: MGYG000000815_00721

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_00721
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43141.33	7.4375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 915028; End: 916173 Strand: +

Full Sequence      

MKYFLVAGEASGDLHASNLMSALKSKDPHADFRFFGGDLMLAQGGIMLKHYRELAFMGFI
PVLLNLGTILRNMKICQEAIIEYQPDVVILIDYPGFNLKIAKFVKTKTSIPVHYYISPKV
WAWKEYRVKSFKKYVDEMLCILPFEVDFFKKHNYKVDYVGNPTVDAVAHYRNSSIDDTPE
LFVESNSLESKPIIALLAGSRKQEIKDNLPAMLEVVSAFPAYQPVIAGAPGIDAGYYKEY
IGTHDCKIVFGQTYRLLTYAEVALVTSGTATLETALLRTPQVVCYKTPVPKLVYWFFKNI
LHTPYISLVNLIAGEEVVKELFAKFFTQKNIQNEVDLLLNDLEYRSNMLENYDRIISILG
APGASEKAARIIIEKLDKTIL

Enzyme Prediction     

No EC number prediction in MGYG000000815_00721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	8.8e-115	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.15e-109	1	378	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.21e-103	1	378	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.17e-75	4	347	2	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.83e-67	5	374	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.91e-54	1	372	1	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK59046.1	3.31e-214	1	376	1	376
QIK53577.1	1.28e-211	1	376	1	376
ABR44355.1	5.91e-179	1	376	1	375
QRO15504.1	5.91e-179	1	376	1	375
QCY57761.1	5.91e-179	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.01e-33	5	321	11	327	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.01e-33	5	321	11	327	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.29e-69	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.03e-62	5	379	8	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	2.64e-59	2	379	8	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.49e-58	2	378	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	1.70e-58	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999780	0.000216	0.000007	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_00721.