CAZyme Information: MGYG000000815_01114

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01114
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MGYG000000815_2|CGC1	62725.82	9.6346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 2834; End: 4468 Strand: -

Full Sequence      

MTNTQNHLIHYLFIIVVCFFAFFVNNQIIPADLMESRNLATAQEMIHTDNYLMPTMNGEP
RLEKPPLPTWIAAGVELLFPENLVVQRYMAAISATIMVFFLYFLVSRLTKNRNIGLLSSL
VLASCFNIILMGRTATWDIYCHSFMLGAIYFLVLGLEEKGKQWGHFFITGLFLGLSFLSK
GPVSFYALLLPFLISYIIVLRPSAKDKVLPILIMILTCLVISTWWPVYARLSHPGLAVAV
ADKESSSWLNHNVRPLYYYWQFPAEAGIWALFWITSLCWFHWKKKIENRHVYIFSVIWTL
AAFILLSLIPEKKTRYLLPMLIPGAINIGFYIYHCANSIMTSKEKNTFRFNIIVIILILV
ALPVALYIMFFKDGMVTLPLYIVTSVISICLAVFLIISVFNKYRINVLKAFTGILLTMIM
VEGLCMIPVRNMFINNDRHSIRMLRKIDKVQNMPFFYNEKEQLRMELVYEANQVIRPLNV
SDSALIQSKLPFVFVSGAPIDSLLAGKNVKIEYIDTFDNNWQKSSSRRYNEDLVRQVAII
SRLK

Enzyme Prediction     

No EC number prediction in MGYG000000815_01114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	421	2.7e-65	0.7759259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.43e-35	11	396	10	400	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.11e-17	64	226	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	6.37e-14	19	401	11	399	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	5.11e-06	63	225	61	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	1.39e-05	63	180	89	209	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ23342.1	5.27e-20	21	334	14	346
CAJ74247.1	4.30e-18	35	347	37	354
ADR19199.1	1.30e-17	35	362	33	375
BAT71475.1	3.82e-17	35	333	31	340
AEI13959.1	5.58e-17	35	343	34	340

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.11e-14	35	370	30	354	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A1JPM4	4.28e-14	35	353	34	355	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
B2K5L1	1.56e-11	35	345	34	347	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
B1JJ32	1.56e-11	35	345	34	347	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=arnT PE=3 SV=1
Q66A06	1.56e-11	35	345	34	347	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000034	0.000002	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
7	29
84	106
113	135
139	156
163	178
183	200
207	229
258	280
292	309
314	336
349	371
381	400
407	429