CAZyme Information: MGYG000000815_01291

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01291
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000000815_2|CGC4	87446.29	5.7807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 237432; End: 239777 Strand: -

Full Sequence      

MSLCAIGLCLVSQNMVAADAKEINSGKWKIAYNEKTRALDYSYNGQIILSNVSVRAKIVN
DTIKSSDYVAVVLKKEAVSDQFGNGEKYTFTYSGEGNKPSIDQAFYFYPGYQYLLTEASI
LAQTEISSNYIAPVYTTADNEFLPSDAANRILRVPFDNDGFVRYLSSPFNVSDVSFEVTS
IFNGGNRKGLVIGSVEHDTWKTGIDYTVKNHNNLSKLECYGGVVHELTRDIPTNGTPSAI
HGSIKGKSLKSPKIMLGLFDDWREGLEEYGAANALIAPPRKWKAGTPFGWNSWAAMAEKV
NYEGAVDVADFIKKDLQPNNFQNNNTVFIGLDSFWDNFSDDQLRKFVENCTKNGQQAGIY
WCPFSDWWGDGERNVEGTAGEWKYKDLYLYRNGQPRKIASLALDPTHPGTKKLQEHYINR
FKALGFKYIKLDFVNNATLEADSFYNSKVTTGVQAYNEGMSYLMSLCGEDMFTALSIAPM
FPSQYGNSRRISCDTWGAMHENDWGSTGYMLNSLSFGWWLDRVYTFNDADHILLYKPSEA
NNYKEGANRARVTSAVITGIYMLGDNFSMKGSFQGEYEARVKAKQFVTNKDINDIARIGK
SFAPVEGYKAVSADRSENFFVYETDIYLYFVAFNFDADKELKGTVPLSRLTAQVDKYTAL
KELWSGKTSSVSNKSITYSVAPKDVQVFRAEKSEIAGIGDDVICKQGDLLSFVDVDSNLI
IESTEMLKSLNIYSLHGSLILNRTLTSTDNYSVSVKDFPKGAYILNVFTDSGKNIQSKFV
R

Enzyme Prediction     

No EC number prediction in MGYG000000815_01291.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.44e-09	287	566	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam18962	Por_Secre_tail	2.39e-05	715	780	6	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
cd14792	GH27	2.84e-04	287	530	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
TIGR04183	Por_Secre_tail	0.002	718	780	11	70	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam17801	Melibiase_C	0.010	629	689	17	73	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EIY66649.1	8.07e-206	2	692	59	748
QUT74114.1	3.65e-204	2	692	59	748
BCI61924.1	1.12e-201	6	689	9	687
QQY38591.1	2.27e-191	23	692	34	675
ABR38452.1	2.27e-191	23	692	34	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000383	0.998960	0.000178	0.000165	0.000147	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_01291.