CAZyme Information: MGYG000000815_01533

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01533
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	MGYG000000815_3|CGC2	96382.27	6.1262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 164123; End: 166636 Strand: +

Full Sequence      

MKNLRHIILPVLLIYCSFYMLNGNNIRFIKYEKSSSSMILFESGSRLKILTNETALPGVK
IAVKNLQADFYKVTGVEPDLGTEISNSNQPVLIIGTVGVDQSIDELIKKGKLNKDELSGK
NEKYLIQNVTDPFDGIKEAIVIAGSDKRGTIYGIYELSKQIGVSPWYYWADVPIEKRSVL
SFERGNYTDGEPAVKYRGIFLNDEAPALSGWSHTVFGGYNHKFYEKVFELILRLKGNFLW
PAMWNNAFYDDDPLNGPLADEYGIVMSTSHHEPMSLAQKDWHRKGNGSWNYNTNSKNLKS
FWKSGIERSNNWERVVTIGMRGDGDEAMEEGTNIALLEKIVKDQRNIITQVTGKRAEETP
QVWALYKEVQDYYDHGMRVPDDITLLFCDDNWGNIRKLPELDAKPRKGGYGMYYHFDYVG
GPRNSKWINISPVQRIWEQMNLTYQHGVDKIWVVNVGDLKPMEYPISFFLDMAWNPNQFN
ADNLLQHTEQWCAQQFGEKYAKESARIINLYTKYNRRVTPELLNEKTYSLENYNEFETVV
NDYRNLVIDAMRLYYLIPDTYKDAFDQLVVFPVNACSNLYEMYYAVAKNRFYVDQKDIQA
NYWADKAKECFERDSVLTLHYNNDIANGKWPHMMDQVRIGYTTWQQPDRSIMPKVEYIMQ
TAQYKEKVFEEADGYVSIEAENYSRHQSEGNIEWTVIPHFGKTLSGITTLPVTSSPENKS
VYLEYDMDLKTIGEGKLIILTAPTLNFNSNRGLRYAVSIDGGEEQVVNINGHYKGELGKW
QAESIIETSSKFKISTTGRHTIRFRVLDAGIVLQKIMLDMVGLKPSYLGAPQSQYTK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	37	816	3e-284	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	190	522	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.23e-57	668	831	1	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	5.19e-05	57	157	31	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK60872.1	0.0	27	837	28	835
QIK55455.1	0.0	27	837	28	835
CCO21037.1	0.0	47	834	1	786
CCO21109.1	0.0	47	834	1	786
CCO21320.1	0.0	47	834	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	1.14e-281	27	834	33	850	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.30e-266	23	833	2	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.86e-263	23	833	1	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.00e-227	33	833	9	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.37e-142	35	835	8	965	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.039233	0.713776	0.245818	0.000326	0.000337	0.000467

TMHMM  Annotations     

start	end
7	29