CAZyme Information: MGYG000000815_01662

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01662
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000000815_3|CGC7	36625.64	8.0058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 346562; End: 347521 Strand: -

Full Sequence      

MKKTIYLFFLLCFSLTLFASEDSRTIVVDRNGTGHFRNIQQAIDSVRAFDPKGEITIFVK
KGVYKEKLILHSYLTNVKLVGEDRDKTIINYDDHANINKMGTFRTYSFLLSGNDITVENL
TIENSAAPMGQAVALFVEGDRVIFRNCRFLGNQDTIYVGRENMRQYFENCYIEGTTDFIF
GPSTCWFENCVIYCKSNSYITAASTPENIKYGYIFNNCKIEVASEVKNMYLGRPWRAYAM
TLFMNCYLPKGIKAEGWHNWSNAENEKTARYMEYNNTGEGASTSGRVNWVKILNRQQAAE
YTVENVFKGCDGWNPVTKK

Enzyme Prediction     

No EC number prediction in MGYG000000815_01662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	26	308	1.2e-104	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	4.80e-78	26	309	2	297	Pectinesterase.
PLN02773	PLN02773	3.71e-75	22	301	3	290	pectinesterase
COG4677	PemB	8.71e-67	36	309	94	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	3.68e-64	26	313	13	291	putative pectinesterase
PLN02197	PLN02197	5.35e-62	24	305	275	569	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53311.1	2.74e-177	3	319	2	317
QIK58728.1	3.19e-176	3	319	2	317
QQY38333.1	1.97e-132	1	316	1	315
ALK82867.1	1.97e-132	1	316	1	315
QEW38158.1	1.97e-132	1	316	1	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.25e-39	26	317	9	311	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.16e-38	27	309	6	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.13e-37	20	286	5	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.10e-37	20	286	5	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.72e-28	36	315	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.48e-56	23	301	4	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O49298	8.58e-54	21	309	241	539	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q5MFV8	1.27e-50	25	305	283	576	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2
Q8GXA1	1.63e-50	27	318	259	561	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q5MFV6	5.98e-49	25	305	276	569	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000395	0.998821	0.000263	0.000167	0.000165	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_01662.