CAZyme Information: MGYG000000815_01737

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01737
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000000815_4|CGC2	45778.31	7.8437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 53209; End: 54414 Strand: +

Full Sequence      

MKIQIVIFLWISGIVLCAQNKTVDKSLLPAINKRLHFAVEQEIKMAQSVQDKSGKFPVTV
DKKGDLVLCDTTSWTCGFFPGTLWYLYEYSKNEQVKKYAQMFSDRLEGMQYATNTHDIGF
IIYCSYGNGYRLTGNTDYRTKIEKAAEALCVRFNPVTGCIKSWDRGENIYPVIIDNMMNL
ELLFEASKLTGNNKYRDVAITHANTTLKNHFRNDASCYHVVFYDPKTGQVTARKTRQGFA
DESAWSRGQAWALYGYTLCYRETKDPAYLSQAQKIASFILNHPRLPEDKIPYWDFDDTKI
PNAERDASAGAIISSALMELSLYVPQDEAKRYLDIAKKQLVSLSSPAYLAKDASNRNFLL
MHSVGSMPDDIEVDVPLSYADYYYLEALIRYRKLIQGVSLF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	70	391	1.3e-130	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.77e-21	44	394	4	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.002	165	345	396	569	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	0.002	183	338	503	619	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG4225	YesR	0.008	260	298	92	136	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW58625.1	2.06e-153	17	401	17	405
QUT50637.1	1.33e-149	19	395	20	398
QIA07645.1	8.74e-147	7	394	7	398
ASZ14553.1	2.10e-146	18	393	22	396
QRQ54628.1	2.67e-144	1	393	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.27e-116	31	394	32	391	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.46e-61	38	393	31	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.50e-61	38	393	32	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	5.83e-61	38	393	32	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	8.19e-61	38	393	32	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.22e-102	74	395	77	398	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9A0T3	2.80e-62	56	393	52	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	8.19e-61	38	393	32	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	4.95e-58	56	393	49	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	2.90e-54	46	397	14	370	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999173	0.000146	0.000145	0.000136	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_01737.