CAZyme Information: MGYG000000815_01814

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_01814
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000000815_4|CGC5	36758.76	5.799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 159073; End: 160035 Strand: -

Full Sequence      

MRRIYHNYIAVFLMLLLVIPVYGQGVVTRNGSLSVRETSLVNNKGENITLRGVSLGWHNW
WPRFFNNKTISWLHQDWKTDIVRVAVGVEPEGAYLDNPDFGIECATKAIDAAIKNDMYVI
IDWHSHHIHSEEAKAFFTQIAQKYKGYPNIIYEIFNEPVDLSWAEIKKYAEEVIGVIRSI
DSENIILVGTPNWDQDVDVAADSPIVGYKNIMYTLHFYAATHKEHFRDKADYALSKGLPI
FVSECAGMEATGDGPVDVAEWNLWTEWMKQNNISWVAWSIADKNETCSMIKNTDSAINKW
GEKDLKEWGQLVRKTLRNEK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	44	276	7.8e-101	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.07e-58	41	284	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.03e-05	107	285	120	280	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK58758.1	4.48e-154	30	319	40	329
AGL50932.1	1.82e-153	30	319	40	329
QIK53341.1	3.66e-153	30	319	40	329
QRQ63760.1	5.72e-135	26	317	33	324
AWW31171.1	1.28e-134	33	316	36	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.14e-79	22	317	2	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	2.00e-77	27	316	6	302	Endo-glucanasechimera C10 [uncultured bacterium]
5IHS_A	3.95e-77	26	317	28	321	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
1H11_A	3.34e-76	24	317	3	301	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1E5J_A	3.55e-76	24	317	3	301	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O85465	1.12e-74	10	317	6	327	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	4.51e-73	26	317	31	327	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07983	4.62e-72	27	320	36	333	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	1.41e-70	27	316	36	329	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P15704	2.20e-70	31	316	45	335	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999132	0.000152	0.000156	0.000143	0.000133

TMHMM  Annotations     

start	end
5	27