CAZyme Information: MGYG000000815_02640

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_02640
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290	MGYG000000815_6|CGC3	34327.08	8.5562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 323990; End: 324862 Strand: +

Full Sequence      

MQAILITAYKNIEHLEEIVRFFGEEFNIYIHIDKKSKITTESIDELLKNKNIAYISRQYK
INWGGLNHLLAIVELAEQAFSDERNEYFHLITGHDFPIKSKNDFSDFINKNKHSNYMEYH
KLPYADWPEGGMDRLSRYNLYDLIDGRTGSKEILLKRFSKIQKLLGIKRRLSNNFPDQYG
GSTYWSLNREALEYTFSFMRNNPDYLKRFKYTFCAEEIFFQTILLNSPLKETIINNNLRF
IVWENRNGNFPANLDNTDYNNIKKSEALFARKFEYPASTGLLAIIKQDII

Enzyme Prediction     

No EC number prediction in MGYG000000815_02640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	5	258	3.3e-51	0.976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	7.41e-18	3	248	2	231	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	1.08e-06	179	273	254	350	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK59699.1	3.48e-141	1	289	1	289
QIK54296.1	2.84e-140	1	289	1	289
QII69802.1	1.17e-73	2	289	3	289
QII71760.1	2.42e-67	2	273	3	271
QYN49131.1	2.42e-67	2	273	3	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	2.17e-11	29	290	149	401	HumanXylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	2.18e-11	29	290	153	405	HumanXylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q811B1	9.04e-12	8	290	332	603	Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1
Q5QQ50	6.90e-11	5	285	238	518	Xylosyltransferase 2 OS=Canis lupus familiaris OX=9615 GN=XYLT2 PE=2 SV=1
Q9EPI0	9.25e-11	5	285	238	518	Xylosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Xylt2 PE=2 SV=1
Q9EPI1	1.22e-10	29	290	222	474	Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
Q5QQ57	1.27e-10	29	290	343	595	Xylosyltransferase 1 OS=Pan troglodytes OX=9598 GN=XYLT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_02640.