CAZyme Information: MGYG000000815_02817

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_02817
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177	MGYG000000815_7|CGC2	20771.73	9.6371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 156211; End: 156744 Strand: -

Full Sequence      

MMKITNEQLKQIYTYSTQANRDKYLPYINQFSSEYNMDTYEAMCAFLAQIGHESGQLRYV
EEIASGQAYENRKDLGNIYKGDGIMYKGRGLIQITGRANYTSLSKNLKIDFITNPYLLKE
PLYAVLSAFWYWDKRKLNKYSTLNETDFITLTKRINGGLNGYKDRFRIWNLAKQILQ

Enzyme Prediction     

No EC number prediction in MGYG000000815_02817.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	8	160	2.3e-33	0.7402597402597403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	1.15e-38	1	176	1	204	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	2.64e-14	45	159	51	190	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	1.82e-08	1	141	10	163	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK58799.1	7.92e-78	4	177	2	180
QIK55024.1	7.09e-70	2	176	1	181
QIK60455.1	1.01e-69	2	176	1	181
QIK56086.1	3.27e-48	4	176	5	213
AJD82926.1	4.48e-48	1	176	1	175

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	2.84e-20	23	176	34	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
1WVU_A	2.90e-09	45	159	110	231	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
2CJL_A	5.37e-07	45	159	49	170	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64203	2.75e-22	46	172	221	357	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
P44187	9.38e-14	46	169	43	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O22841	3.67e-09	43	158	140	249	Endochitinase At2g43620 OS=Arabidopsis thaliana OX=3702 GN=At2g43620 PE=3 SV=1
O04138	5.27e-07	36	159	131	251	Chitinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht4 PE=2 SV=2
Q7Y1Z0	3.34e-06	36	159	134	254	Chitinase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_02817.