CAZyme Information: MGYG000000815_03716

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_03716
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		90654.8	6.3542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 406; End: 2802 Strand: +

Full Sequence      

MGIETPQNQIMKKILTLTVVLFTGSLFYGQAQIVQKVESFDIGNVRLLDSPFKHAEDLDL
KYMLELNPDRLLAPFLREAGLPQKAESYTNWENTGLDGHIGGHYLSALSLMYAAIGDSRI
KERLDYMVGELKKCQDANGNGYIGGVPGGKAIWEEVANGKIDAGGFSLNGKWVPLYNIHK
TYAGLRDAYLYAHNQEAKEMLIKMTDWAIKLVSQLSEVQIQDMLRSEHGGLNETFADVAA
ITGDKKYLALAHQFSQQLILDPLLSHEDKLTGMHANTQIPKVLGFKRIADIEGNQSWNDA
ARFFWDTVVENRSVAIGGNSVGEHFNPTNDFSRMIKSIEGPETCNTYNMLRLSKMLYQTS
QDKKYMDYYEKALYNHILSTQNPEQGGFVYFTQMRPGHYRVYSQPQTSFWCCVGSGLENH
AKYGEMIYSHKDNQLYLNLFIPSTLTWQEKKIEIVQENNFPDEAKTSLTVKTGKASDFDL
KIRYPQWVKDGDLKVSVNGKPQAVVKGADGYVSINRKWKNGDKIVVDMPMHLRVEQLPDK
SNYYAFFYGPIVLAAKTNTENMDGLFADDSRGGHIAHGQQVPLKDMPIVVSEPDKLISQL
QPVANKPLTFKITGLYPEKYSNGLELIPFFRLHESRYIIYWPQATQSEVAAIQQRTADEE
QERIKLDAVTTDKVICGEQQPESDHFVKFENSNTGFIDDVHWREAKGWFSYQLKNTNKNA
KYLYIRYFNRDDSRILNIQINNQTVVSKALDGNDGDKIITERIELPSDLNNTDILEVKFT
STSDKMATKIVEVRLLNN

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	44	554	4.9e-222	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	44	554	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.32e-117	62	630	29	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	4.13e-41	559	641	2	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK52968.1	0.0	31	797	19	784
SCD19719.1	0.0	28	797	18	786
QRX64622.1	0.0	29	797	20	787
AZA94403.1	0.0	18	796	6	784
AZA85995.1	0.0	18	796	6	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.57e-309	25	796	13	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.12e-298	25	796	13	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	2.74e-22	242	556	206	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.29e-20	267	566	258	574	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.72e-18	267	566	258	574	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.075644	0.916853	0.006425	0.000378	0.000329	0.000344

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_03716.