CAZyme Information: MGYG000000820_00781

Basic Information

• Species: UBA9506 sp003506415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UBA9506; UBA9506 sp003506415
• CAZyme ID: MGYG000000820_00781
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		39544.32	4.6874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000820	2712076	MAG	China	Asia

• Gene Location: Start: 54722; End: 55765 Strand: -

Full Sequence      

MKEILKKVADNMTAIKNQGIEEECPIGIIDIENWEWPQGVGMYGMYKYYKELGDTSYRDF
LIKWYDKNIAKGLPERNVNTMCPMLTLAHLAEETGRKDYLDLCTEWAEWVMNEMPRTEGG
GIQHIVSGGENHNQVWIDTLFMTVLFLAKMGLLLDRKEYIEEAKFQFLFHIKYLADKKTG
FWFHGWTFDGRHNFADALWARGNCWYTAGSVEFIEMLGLEGSLKEYLLNTLVFQVEALAK
TQDESGGWHTLLDDPSSYLEASATAGFGYGILKAVRLGYIDEKYKVVGEKALKYVIDNIA
EDGEVQNVSYGTGMGATLEDYRVIPICPMTYGQSLALLILTEGVRLK

Enzyme Prediction     

No EC number prediction in MGYG000000820_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	342	2.6e-106	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.27e-108	34	342	34	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.33e-99	10	347	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98394.1	5.25e-144	1	345	9	352
QUL58446.1	1.15e-140	20	345	27	352
AIQ43751.1	4.65e-140	5	345	13	352
AGX06452.1	1.40e-133	5	345	12	353
AYA66676.1	2.72e-130	5	342	17	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	2.10e-119	4	345	30	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	8.18e-119	1	345	26	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.07e-93	33	345	46	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	9.13e-25	32	315	21	323	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	9.11e-14	133	326	197	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	7.74e-55	34	347	29	339	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.08e-06	142	314	1	184	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.08e-06	142	314	1	184	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000820_00781.