CAZyme Information: MGYG000000820_01096

Basic Information

• Species: UBA9506 sp003506415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UBA9506; UBA9506 sp003506415
• CAZyme ID: MGYG000000820_01096
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673		76709.79	6.2327

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000820	2712076	MAG	China	Asia

• Gene Location: Start: 103179; End: 105200 Strand: -

Full Sequence      

MGKQHKFCGKWITCEDMAALPAINVFHRQLDGKTVPDSKFQNKHMLFRKKFIAETTKGTT
LFLSADDYYKLYINGRFVTQGPCPGYPFHYYYNELDISAYLKKGENTIAVHVFYQGLINR
VWVSGDNRSGLILDIVSGGKTVLSSDESFLVSDQTAFSAIGDVCGLNTQYCERFNAGHPN
VLFDQPDFDDSNWRPAALRAFPDYTLYPQPTKQLVFEPIRPAALKKNEQGYLVDFGAMYV
GYLSFSASGSRGSVIAVKSGQELCDGGTDVMFHLRANCVYKDEMVLSGNRDFYCQFDYKS
FRYVQLDLPPDCVLDENSICLTARHYPFCEQAACNTDDPELHAVWSLCARSLKYGVQEVI
QDCMEREKGQYVGDGCFTSLSYALLTKDFSIMEKLIDDALRSQFVNKGLLTCTTCSFMQE
IAEYPLMLVMLLFAHYHIKKDKEFIAQRYDALLDILTFYQKSYGKADGLLYDLDKWCVVE
WPQKWRDGYDVDLTEGQICRGTHNVINAYFIGAAKALNRLASIVGKRPAFDTVFLTDAYR
NAFYDPEQGFFCDSAESRHISFPSNAIALAFGLCPDRACEERIIQMMDKRRLSGCMLFMT
FAAFCGLVRCGRRDLVYEMMKDKGGWLRMINEGATATFEGWGKSEKHNISLFHLCLTYPI
VFLTDWNMEQIFK

Enzyme Prediction     

No EC number prediction in MGYG000000820_01096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	227	664	2.3e-64	0.8571428571428571
CBM67	41	199	2.5e-31	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08531	Bac_rhamnosid_N	5.25e-17	59	220	6	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17389	Bac_rhamnosid6H	6.02e-17	335	641	7	312	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.55e-08	225	325	2	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam02837	Glyco_hydro_2_N	1.24e-05	61	113	87	134	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	5.13e-04	62	115	132	179	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	2.21e-241	7	671	75	740
BBH20286.1	7.90e-136	11	665	9	669
AEN95938.1	1.36e-130	10	660	28	680
QCT01521.1	3.99e-129	21	665	20	668
QBE96895.1	3.26e-127	6	665	3	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.52e-12	46	306	178	441	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	1.23e-10	41	225	20	209	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
592	611