CAZyme Information: MGYG000000820_01408

Basic Information

• Species: UBA9506 sp003506415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UBA9506; UBA9506 sp003506415
• CAZyme ID: MGYG000000820_01408
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782		87022.42	4.7618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000820	2712076	MAG	China	Asia

• Gene Location: Start: 65726; End: 68074 Strand: +

Full Sequence      

MNLSMNFIKANDQMCTFDHHVNAPLFRKRFTLDKTPRWAKITICGLGFYELFVNGKNITK
GPLAPYISAPDDLCYFDCYDVADYLTEGENVIGVMLGNGMHNAFGGFIWDFEKASWRSSV
KFAMTLTANGQELFSADETFVTHPSPITFDDLRMGCWYDANLELPGWSEPGFDDSSWQPA
QSADAPRGTPKLCEAEPIAVSAEIKPVNIFKCTGGYIYDFGVNTAGVCRLKINGRPGQKI
TMTHVEILMDKKPYLENISFVRPESWDIYQKYNQKDVYICRGGEAEFVPCFTYHGFQYVF
VEGLSEDQATKDALTYLEMHSDLPVRGSFSCSDSTVNKLYEMAHRSDLANFYYFPTDCPH
REKNGWTGDASMSAEHMLQWLGAEKSFAEWLANIRACQREDGAVPGIVPTGGWGFEWGNG
PAWDSVIVNLPYYTYQYTGDKKIIIDNASMIMRYLHYATTQFDERGLLAIGLGDWLQPME
DGTAATNSADAPLELTDSAIVFDMANKASFLFEQVGLLPQARFAAHIAGNLLNALRINLM
DPKTCTAAGNCQTSQALFLALGLFKDEEIPQAKQVLLDMIHKKNDHLSSGMIGLRYLFHV
LSALGESELAYAMITNDTYPGYGQWVKDGATTLYENFEKDLSFQEGETAHIPSLNHHFLG
DIASWFVKSLAGLRFNPNADDVRRADVCPSFVDGLAFAKAEFTAPDGKISVGWKRADRNV
DDFVNKIRNTDAGGAINTIVLSVTAPETIHGQIVLPKGYSFLRGGTCCDLEGGTYTIVKD
VE

Enzyme Prediction     

No EC number prediction in MGYG000000820_01408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	214	719	1.3e-116	0.9523809523809523
CBM67	20	190	5.6e-29	0.9204545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.10e-76	327	670	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.18e-37	34	200	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.47e-16	214	320	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.001	672	756	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.40e-140	21	714	141	818
AYB33152.1	2.71e-134	16	775	177	915
AYD48149.1	3.99e-132	19	715	152	837
ANI90810.1	1.90e-130	23	764	148	876
SDT57200.1	6.14e-128	18	732	141	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.20e-91	23	757	176	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.44e-66	39	715	319	973	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	9.41e-65	10	775	118	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.90e-78	27	760	174	883	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	6.69e-76	23	778	184	948	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.39e-69	18	760	168	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	2.21e-65	39	715	319	973	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000820_01408.