CAZyme Information: MGYG000000820_02353

Basic Information

• Species: UBA9506 sp003506415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506; UBA9506; UBA9506 sp003506415
• CAZyme ID: MGYG000000820_02353
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		26432.5	6.8496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000820	2712076	MAG	China	Asia

• Gene Location: Start: 13702; End: 14403 Strand: +

Full Sequence      

MKKLLKRLILLLLLAIICAGAYFTAAGYVMYKKATQAISVVQKVKEVRTEDCYTTLDQIP
DIYEDAVISVEDHRFYKHHGVDVIALGRALVKNIQTMEFSQGGSTITQQLAKNLFFTNEK
KIERKAAELFVVYQLEKNYAKDVILELYINTVYYGDGYYCVKDAAEGYFNKEPAEMTDYE
STMLAGIPNAPSVYAPTKNNDLAQKRQEHVLNRMVKCGAITEEQKQKILAEAD

Enzyme Prediction     

No EC number prediction in MGYG000000820_02353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	215	2.2e-62	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.36e-78	53	215	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.90e-76	53	227	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	8.93e-75	29	231	57	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.35e-66	53	231	69	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	6.48e-47	29	231	25	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU22158.1	9.49e-90	12	230	14	232
QRP41835.1	1.91e-89	12	230	14	232
ASN93505.1	1.91e-89	12	230	14	232
ANU46909.1	5.45e-89	12	230	14	232
QQQ98385.1	5.45e-89	12	230	14	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	8.81e-42	53	224	22	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.48e-41	53	224	22	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	3.66e-36	41	231	47	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	3.90e-36	41	231	11	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	4.01e-36	41	231	12	208	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.09e-41	53	231	70	248	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P39793	8.48e-41	42	227	85	272	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q07259	1.15e-40	1	221	1	216	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87579	1.82e-40	53	231	70	248	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	3.40e-40	53	231	70	248	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.661181	0.154017	0.174534	0.001093	0.000547	0.008633

TMHMM  Annotations     

start	end
7	29