CAZyme Information: MGYG000000822_00352

Basic Information

• Species: Companilactobacillus farciminis_A
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis_A
• CAZyme ID: MGYG000000822_00352
• CAZy Family: GH8
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000822_3|CGC1	44129.32	10.2661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000822	2370791	MAG	China	Asia

• Gene Location: Start: 17144; End: 18304 Strand: -

Full Sequence      

MFRRHKYQWLIGGLIILVTFAIGIAIYNTQSQERQIGISSQKIQSQYRIWKKYYLKGNEI
QKFVKTNNGSKNRTLSEAQGYGMVITVMAAQQGFGSQKTFDQLTNYYLNHRISSQNSLMA
WRQNQQGERMTSTRAEKTSATDGDLDIAYSLILADKKWGSNGKLNYHELALQLLNDIYKR
EINPKTALPKVGNWAHGKNENVVRTSDLISAYFRDFASYTKDGRWTKTMQNSQRTLQELS
GQHRTGLMADFVVVSGNNLNIKAVKANQIASKYDAQYGFNACRIPWRVAYDYQLNHSQIS
KSVVTKIDRFFARKKNITAIYTLDGKPMETYENEAFCAPVAYSAEVLGNQTLKNRYKKIL
TAPIRSKDYYPATIQMLTLLASGELK

Enzyme Prediction     

No EC number prediction in MGYG000000822_00352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	45	381	3.7e-79	0.990625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	4.63e-33	46	383	7	320	Glycosyl hydrolases family 8.
COG3405	BcsZ	3.12e-13	37	291	16	254	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.21e-09	71	275	49	246	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT85170.1	1.20e-283	1	386	1	386
AKS52569.1	3.71e-266	22	386	1	365
AKP04262.1	3.71e-266	22	386	1	365
QCX23692.1	5.21e-224	1	385	1	385
ATO45419.1	5.77e-211	1	386	2	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.07e-48	43	380	62	400	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	2.32e-35	43	354	31	351	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	2.77e-35	43	354	37	357	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1CEM_A	1.07e-33	43	380	27	350	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	7.58e-33	43	380	27	350	ChainA, Endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	5.85e-48	43	380	62	400	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	3.81e-32	43	339	87	391	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	8.54e-32	43	380	59	382	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37699	2.91e-29	27	380	49	383	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2
P37701	4.95e-28	43	380	63	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993462	0.001172	0.000550	0.000010	0.000006	0.004843

TMHMM  Annotations     

start	end
7	29