CAZyme Information: MGYG000000822_00624

Basic Information

• Species: Companilactobacillus farciminis_A
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis_A
• CAZyme ID: MGYG000000822_00624
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	MGYG000000822_5|CGC1	57331.7	5.4843

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000822	2370791	MAG	China	Asia

• Gene Location: Start: 21215; End: 22711 Strand: -

Full Sequence      

MTIKTFPENFLWGGSTSANQIEGAWNIDGKGPSVADVQLFRNPQTVAELNNVKGNTDITD
DMIDTALKSNSEYNYPKRHGIDFYHHYKEDIALFAEMGFKAYRFSIAWSRIFPNGDDKYA
NKKGLEFYSDVVNECLKYNIEPIITLSHYEIPLNLCTKYNGWYDRRTIGFFLNYVKTVID
ELGDKVHYWLTFNEIDSILRHPFMTGGLIENRFPKDKFQTVLYQAMHHQLVASSLATKYI
HEINSDSKVGCMTTKLTYYPYSSKPSDVLATKEKMRQVYAFADIQVFGEYPSYLLSKFKN
ENINIKMTKEDLSILKENTVDFVSFSYYQTSCVASDESNLELTSGNTTIGVKNPYLPSSE
WGWQIDPTGLRISLIDLYDRYRIPLMIVENGLGAKDTLESDFTIHDNYRIKYLAAHIKAM
YDAIYEDGVDLMGYTPWGPIDLLSNSTIQMSKRYGFIYVDLNDDGSGSYNRYKKDSFYWY
KDVISSNGSSILNEKVLN

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	488	2.3e-146	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	5	491	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	5	491	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	4	490	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	491	1	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.47e-179	5	491	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT84151.1	0.0	1	498	1	498
AKP03801.1	0.0	1	498	1	498
AKS52106.1	0.0	1	498	1	498
QQY27844.1	5.44e-245	4	494	3	492
QMW73407.1	7.73e-245	4	494	3	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.63e-179	4	491	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	9.22e-171	1	491	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	9.86e-166	5	491	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.51e-157	3	491	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.29e-157	3	491	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	8.32e-178	5	491	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.37e-176	4	491	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	5.40e-165	5	491	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	2.49e-163	7	491	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q48409	2.43e-162	3	491	1	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000822_00624.