CAZyme Information: MGYG000000822_01867

Basic Information

• Species: Companilactobacillus farciminis_A
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Companilactobacillus; Companilactobacillus farciminis_A
• CAZyme ID: MGYG000000822_01867
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000000822_28|CGC1	24901.21	10.1511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000822	2370791	MAG	China	Asia

• Gene Location: Start: 4889; End: 5536 Strand: +

Full Sequence      

MPQKRRYTAHKSYRRKRSRKNNNTTFILLAIVAVFVISFFGYRGYVHHQNETKVEMVQQE
HNSFVKKVAPYAVELGQEYGVLPSITIAQAILESDWGTSTLASQYNNYFGIKGEDPNNTK
VLQTKEYTNGQWITINGRFRVYSDFRESMKDHTKLLVNGTSWNSQQYKQVIQSKNYIDAA
VALQTDGYATDPGYTSKIIRIIQKYNLKKYDQGIK

Enzyme Prediction     

No EC number prediction in MGYG000000822_01867.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	69	207	1e-39	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.41e-62	63	213	45	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	8.86e-39	59	211	6	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	3.34e-38	64	211	323	472	amidase domain-containing protein.
TIGR02541	flagell_FlgJ	6.35e-30	63	204	150	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
NF038016	sporang_Gsm	1.18e-29	64	211	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKP03314.1	9.46e-152	1	215	1	215
QMT83394.1	9.46e-152	1	215	1	215
AKS51613.1	9.46e-152	1	215	1	215
QCX24084.1	1.00e-137	1	215	1	215
ATO45766.1	1.66e-136	1	215	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.89e-30	63	211	32	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	6.13e-25	64	211	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.29e-16	63	209	3	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.57e-16	63	209	4	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	4.82e-16	77	204	19	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.64e-47	60	212	47	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	9.03e-29	49	211	50	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	6.36e-28	56	211	54	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	2.38e-27	56	211	54	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	2.28e-26	63	211	64	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999978	0.000046	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
24	46