CAZyme Information: MGYG000000823_00391

Basic Information

• Species: Alistipes sp900550375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900550375
• CAZyme ID: MGYG000000823_00391
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42868.32	8.5528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000823	2131500	MAG	China	Asia

• Gene Location: Start: 71982; End: 73112 Strand: +

Full Sequence      

MKYYLIAGEASGDLHGSNLMRGLLKSDPAAEFRFWGGDRMAEVGGRKNQVRDYRETSFFG
IVSVLRNLGTISRQLKECREDLLRYAPDVLILVDYPGFNMKMARFAKEHGIRIFYYIAPK
VWAWREWRVKAIRKYVDRLYIIFPFERDYFPRHGIRPVFEGNPLLDAIAARSTALPSREE
FGRTNGLDERPVVALVAGSRRGEIDANLPLMCALAPRFPEYQFVVTGVSWLDRALYDRYL
SGTEVRFVCDQTYETLHNAVAAVVTSGTATLETALMRIPEVVVYRTVWWQVWLRPYVLKV
PFISLVNLNLGREAVRELVQSSTDPSEAERALRAILPGGPERERMLGDYDELLAVMGGAG
ASDRFAADMVKEVRHD

Enzyme Prediction     

No EC number prediction in MGYG000000823_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	8e-103	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.37e-96	1	373	2	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.20e-94	1	372	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.85e-68	4	347	2	351	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.49e-62	5	367	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.66e-42	1	322	2	303	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL13420.1	1.07e-251	1	374	1	374
BBL04027.1	1.46e-249	1	374	1	374
BBL06737.1	7.96e-202	1	376	1	376
AFL77950.1	9.25e-201	1	373	1	373
BBL11605.1	6.20e-199	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.32e-39	5	352	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.44e-39	5	352	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	9.79e-66	5	366	11	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	2.92e-64	5	373	9	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.82e-61	5	366	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.54e-60	5	366	11	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.26e-58	5	366	11	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000823_00391.