CAZyme Information: MGYG000000824_01032

Basic Information

• Species: CAG-485 sp900552315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900552315
• CAZyme ID: MGYG000000824_01032
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		35196.63	6.5858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000824	2120674	MAG	China	Asia

• Gene Location: Start: 2404; End: 3354 Strand: -

Full Sequence      

MNFYANFAFANLILFYVKTKLALILLCLACFLAGYGQGRRGSSRYTEYIERYAPMAVEQQ
RKHGVPASVTLAQGLLESGAGQSTLATEGNNHFGIKCHTTWQGKTMLRDDDAPDECFRVY
HDAAESFEDHSLFLAKGRRYASLFELEPTDYRGWANGLSAAGYATDPNYAPRLISIIEQY
GLYTYDRPGGEAEDAAALYIMEQLRHTHAVRRSRGLHYVIAVPGDTYATIAREFDLDGDK
LAAYNDASGAGAEIKAWEEVYFQPKLETAPKGVKRVTIGADESAHSVAQRYGVTMEMIAR
LNPGYRDEPGTRLKLR

Enzyme Prediction     

No EC number prediction in MGYG000000824_01032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	53	182	3.3e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.51e-41	48	198	46	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	7.25e-35	48	186	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	2.21e-26	53	130	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	7.60e-26	47	186	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	8.01e-22	47	179	154	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47310.1	3.74e-87	14	316	4	306
QRQ47886.1	3.74e-87	14	316	4	306
QDO71591.1	1.17e-85	20	316	5	305
AVM52329.1	5.02e-85	17	316	4	307
CBW22044.1	2.21e-84	31	316	17	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	2.87e-13	47	179	5	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.88e-13	47	179	5	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.52e-13	48	177	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.62e-13	48	177	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.40e-12	48	177	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.05e-15	48	186	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	3.94e-13	37	183	154	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	2.00e-12	48	176	163	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P15931	1.30e-11	47	179	154	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9I4P4	4.67e-11	40	183	231	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999331	0.000566	0.000062	0.000003	0.000002	0.000059

TMHMM  Annotations     

start	end
13	35