CAZyme Information: MGYG000000824_01648

Basic Information

• Species: CAG-485 sp900552315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900552315
• CAZyme ID: MGYG000000824_01648
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		64305.8	5.8069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000824	2120674	MAG	China	Asia

• Gene Location: Start: 95; End: 1816 Strand: -

Full Sequence      

MQKSNPPYDWIFESSWEVCNKIGGIYTVLSTKAKELKKVNGGQLIFVGPDVWSEENPCPV
FKEYPTVFNRASMRLKLPYGIKVRTGRWLVPGEPYAILVDCGEVSSHLPDIYARMWELYG
VDSLHAYGDYGEGCAFGVASAVVINAMVKQLHADPRRVIAHFDEWTTAMGLLWLEDKNPE
IATVFTTHATSIGRSICSNGKPLYDYFEGYHGDQMARELNMESKHSLEKTAARQADCFTT
VSRVTARECSKLLDVEPQVVTPNGFENDFVPKSKAYTMARSASRRKLLALASALTGRPID
NNALLVATSGRNEYRNKGIDLYIDAMDLVRSEHKGQDIVAFIMVPAWSDKPQPGLRERMS
GRPGESPALNFVSHRLHNEESDLIFQRLSQIGGNNNPDAKVLFVYVPCYLDGRDGVLNMS
YYEMMPGLDLTVFPSYYEPWGYTPLESIAFSVPTVSTDKAGFGQWIMDDFDATFEGCGAE
VVERNDHNYEAAKYEIAQKVRFMSMLDEKEKGPIRTVSHRTAAKAAWKRFMAHYQDAYKT
ALSRRDLRVPAEGETAQGETVAGEENVNEKSVD

Enzyme Prediction     

EC	2.4.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	13	348	1e-103	0.543171114599686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03793	GT3_GSY2-like	1.79e-81	10	544	3	590	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
pfam05693	Glycogen_syn	2.68e-74	13	544	1	585	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
COG0438	RfaB	2.16e-12	158	545	87	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	3.76e-10	141	534	64	352	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03821	GT4_Bme6-like	3.61e-08	164	492	73	338	Brucella melitensis Bme6 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU62732.1	9.38e-205	1	548	1	547
ASB36772.1	9.38e-205	1	548	1	547
QQR09930.1	9.38e-205	1	548	1	547
QCD39087.1	1.75e-203	6	548	8	569
QCP72779.1	1.75e-203	6	548	8	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QLB_A	8.54e-64	10	544	47	638	StructuralBasis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_B Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_C Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_D Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans]
4KQ1_A	2.12e-58	11	544	29	635	Crystalstructure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]
3NB0_A	2.15e-58	11	544	30	636	Glucose-6-Phosphateactivated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_B Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_C Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_D Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3RT1_A Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_B Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_C Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_D Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],5SUL_A Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C],5SUL_B Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C]
3NAZ_A	7.75e-58	11	544	30	636	Basalstate form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_B Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_C Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_D Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NCH_A Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_B Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_C Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_D Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3O3C_A Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_B Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_C Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_D Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3RSZ_A Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_B Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_C Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_D Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae]
6U77_A	8.15e-58	11	544	10	616	yGsy2pin complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13807	3.57e-64	11	544	29	615	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2
A7MB78	1.29e-63	11	544	29	615	Glycogen [starch] synthase, muscle OS=Bos taurus OX=9913 GN=GYS1 PE=2 SV=1
P13834	1.76e-63	11	544	29	615	Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus OX=9986 GN=GYS1 PE=1 SV=4
Q5R9H0	2.51e-63	11	544	29	615	Glycogen [starch] synthase, muscle OS=Pongo abelii OX=9601 GN=GYS1 PE=2 SV=1
Q8MJ26	2.51e-63	11	557	29	632	Glycogen [starch] synthase, muscle OS=Macaca mulatta OX=9544 GN=GYS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000824_01648.