CAZyme Information: MGYG000000825_00536

Basic Information

• Species: Duncaniella sp900544535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900544535
• CAZyme ID: MGYG000000825_00536
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989		108904.39	7.1967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000825	2700478	MAG	China	Asia

• Gene Location: Start: 157648; End: 160617 Strand: +

Full Sequence      

MKSRLILSLLTFVSVLSLHARTVRILAIGNSFSRDAVEQNLYEIAAADGDTAVIGNLFIG
GCSLERHLNNVRGNKHDYVYRKIDADGRMSETKNASVADAFADEVWDYVSLQQASPLSGL
YDTYVASLPELLAYVKAKAPKKAGIVLHQTWAYQQGAGHSGFGNYGRDQLTMYRAIVGAN
NRAAKAAKIKIVVPAGTAIQNARTSYIGDNLNRDGYHLDLGIGRFTAACAWYEKLFGKDV
TGNSYLPAGMNPDLARVARAAAHAAVLRPSEITDLSAMEPSMPLYKDSRVPVEIRVADLL
SRMTLEEKVLQLNQYTLGRNNNANNVGEEVKEIPAEIGSLIYFDTDPGLRNAMQRRAVEE
SRLGIPVIFGYDAIHGFRTIYPISLAQACSWNPALVRKACAVSAQEARMSGVDWTFSPMI
DVARDPRWGRVAEGYGEDPYTNAVFCEASVRGYQGKKLSDSTSVAACLKHYVGYGASEAG
RDYVYTEVSPQTLWDTYLLPYEAGVKAGAATLMSSFNDISGVPGSANRYTMTEILKKRWR
HDGFIVSDWGAIEQLKNQGFAADKREAAWRALNAGLEMDMMSHAYDRHLADLVAEGKVSQ
QTVDDAVRRVLRVKFRLGLFDNPYTPEVPDRFLRPSSLETAGQLAAESMVLLKNDSTQIL
PFKDVRRIAVIGPLARDKWDLFGSWCGHGDPETVTTFWDGIVKEFGGKAEIRYAEGCRRD
GNDRSGFKAAADTAAWADVVVLCLGENMKWSGENASRSSISLPAIQEELAAEIARCGKPL
VIVLSNGRPLELNRLEPMANAILEAWQPGVKGGDAVAGILSGRINPSGKLAITFPYSAGQ
IPIYYNRRKSGRHHQGFYQDITSEPLYPFGHGLSYTTYAYGDLTASATDFRRGDRIKVSV
AVTNTGSVAGDETVMWFVSDPYCSITRPVRELKYFEKKHIEPGRTEVYTFTIDPMRDLSF
VDSDGKRFLEAGEYNVIVNGKSIKLNLTE

Enzyme Prediction     

No EC number prediction in MGYG000000825_00536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	359	581	3.1e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	296	978	38	750	beta-glucosidase BglX.
pfam16227	DUF4886	6.47e-130	24	252	1	230	Domain of unknown function (DUF4886). This domain is mainly found in uncharacterized proteins around 290 residues in length and is mainly found in various Bacteroides species. It has a curved central beta sheet flanked by helices. Distant homolog analysis showed it has a similarity with GDSL-like Lipase/Acylhydrose family. The function of this domain is still unknown.
COG1472	BglX	9.24e-100	303	705	1	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.05e-86	287	978	44	768	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.54e-82	304	613	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08785.1	0.0	3	985	4	987
ASB39105.1	0.0	20	985	5	970
ANU64819.2	0.0	20	985	5	970
QDH53358.1	0.0	281	989	26	735
QUT31469.1	0.0	281	989	26	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	6.31e-174	299	984	17	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.50e-173	299	984	17	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	3.36e-163	299	988	16	746	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.28e-160	296	978	7	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	7.07e-160	296	978	7	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	1.68e-160	267	989	15	761	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.30e-159	277	985	14	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.54e-122	315	982	15	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.12e-117	292	976	35	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	4.76e-110	285	988	29	750	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000399	0.998968	0.000179	0.000154	0.000144	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000825_00536.