CAZyme Information: MGYG000000825_01160

Basic Information

• Species: Duncaniella sp900544535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900544535
• CAZyme ID: MGYG000000825_01160
• CAZy Family: GH67
• CAZyme Description: Extracellular xylan exo-alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000000825_10|CGC2	71976.37	5.571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000825	2700478	MAG	China	Asia

• Gene Location: Start: 86512; End: 88431 Strand: +

Full Sequence      

MHKLLILVSALFTLVSCSSSEPAMARRELDREWKGSPVEFRHDSGLKAESFAISRDGATI
VIRSSNDAGALYGAYSLLRDSVSIPREESPAFPLRLLNHWDNLDGTVERGYAGHSLWDWE
ALPDSISPRYEEYARENARIGINGTVLNNVNASPKILSHDYLVKVARLADTFRPYGMKVY
LSVNFASPMVLDSLPTADPLVPEVAAWWKNKADEIYSLIPDFGGFLVKANSEGQPGPMDF
GRTHADGANMLARALAPHKGIVMWRAFVYSPIDADRAKQAYMEFQPLDGQFDSNVIIQIK
NGPIDFQPREPYSPLFGAMPHTAEMVEFQVTQEYLGHANHLAFLAPMWKEFFDYVDPSSL
KAIAGVANIGDSECMTGNPLADANRYAFGRLAWDPSLSSGQIAGEWIGDNLLTADKTMPD
SIYNSLVDMFLTSRETVVDYMMPLGLHHIFAFGHHYGPEPWCDVPGARPDWLPKYYHRAD
SEGLGFDRTTGGSNAVEQYPEPLRSQLNGRDTCPEKFLLWFHHVPWNYRLQSGRTLWDEL
CLHYERGVLAAEDYRRRWQEAAPYIDPALHADVAKRLRTQAADAHWWKDACLQYFREFSR
LPYPAGVTPPTRPLDELKKITLPITNYESPTPALLDSVR

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	41	604	7.3e-239	0.8774289985052317

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	46	602	91	674	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	88	373	15	323	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	1.22e-109	376	606	1	221	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38748.1	0.0	1	639	1	639
QCP72435.1	0.0	1	639	1	639
QCD35193.1	0.0	10	639	39	673
QRQ48276.1	4.03e-306	15	639	39	669
QUT46117.1	9.97e-306	15	639	64	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQI_A	2.03e-194	60	620	110	688	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]
1H41_A	1.63e-193	60	620	110	688	Pseudomonascellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus],1H41_B Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus]
1MQP_A	2.94e-155	60	595	104	663	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1K9D_A	5.87e-155	60	595	104	663	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1MQR_A	8.29e-155	60	595	104	663	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PC73	2.41e-193	60	620	134	712	Extracellular xylan exo-alpha-(1->2)-glucuronosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=gla67A PE=1 SV=1
Q09LY5	1.61e-154	60	595	104	663	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
P96105	6.17e-153	43	606	80	669	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
Q5AQZ4	1.86e-135	49	606	113	698	Alpha-glucuronidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aguA PE=1 SV=1
A2R3X3	8.07e-132	46	606	110	691	Probable alpha-glucuronidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.002407	0.997619	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000825_01160.