CAZyme Information: MGYG000000825_01934

Basic Information

• Species: Duncaniella sp900544535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900544535
• CAZyme ID: MGYG000000825_01934
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	MGYG000000825_23|CGC1	48940.89	8.0681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000825	2700478	MAG	China	Asia

• Gene Location: Start: 41924; End: 43207 Strand: +

Full Sequence      

MKKIKLMLAGALMTVFAAEAVASKPSAPAAEKPKHYSEWMTRSEMKRQPKSYLLDFSDRP
KWSYVMGIELESMLDTYLRYGGDDIKNYCIEYTDTMISPAGEIRRYNLKDYNLDNVRTGH
FVTRMYEHFPEAKNLRAMNTLMLQLNDQPRTKEGVYWHKAIYAYQVWLDGIFMGLPYRVL
TASKIYAPEQALPIYDDAVDQVKKTYERTLDHATGLNRHAWDENRDMFWSDNETGLSQHC
WGRAQGWYTMALIELLDALPEDYARRGEVIDLLKKTFDNVIKWQDPKTGVWYQVMDSPKR
EGNYLESTASAMFAYSLLKAARKGWVGQSYRDAGIKAYKGILKQFIKENPDGTISLTDCC
AVAGLGPGMSPSVQAAAPKVKENKRRDGSYAYYLSEPIRDNDAKGLGPFIWASLEMEQLG
YDTSMKK

Enzyme Prediction     

No EC number prediction in MGYG000000825_01934.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	418	2.9e-114	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.38e-85	36	419	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.40e-72	62	419	34	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD40373.1	3.55e-297	1	427	1	427
QCP71476.1	3.55e-297	1	427	1	427
QCD43358.1	3.89e-255	1	427	1	429
QQR09854.1	2.45e-198	34	424	468	857
ARE60790.1	2.45e-198	34	424	468	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.18e-83	62	419	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	9.39e-55	61	419	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.95e-54	61	419	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	4.74e-19	145	419	178	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	5.33e-15	146	357	143	341	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.14e-54	61	419	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.95e-32	173	415	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.95e-32	173	415	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001258	0.996984	0.000453	0.000465	0.000429	0.000367

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000825_01934.