CAZyme Information: MGYG000000829_00234

Basic Information

• Species: UBA7748 sp900314535
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; UBA7748; UBA7748 sp900314535
• CAZyme ID: MGYG000000829_00234
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		39340.67	5.4665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000829	2305677	MAG	China	Asia

• Gene Location: Start: 49782; End: 50834 Strand: +

Full Sequence      

MTEETRYHGVNLTGWLTLESWVTPELFADSGTLTERDLARVLGPVHYKDLIGVHRRSFIT
EDDFRNIADRGYNAVRLPVPWYVLGADGPAAGPYIGCLSQVDDAIGWGNRCGLKVLLSLA
ISPGASEFRDDPISAAAMSQDRRNELIDLLAELVRRYAVEDSFLGIELADDPVPQKRQGL
WQMSDGVPLHMLRNYYRMAYEAIRNEAGDAPVIVLPDAGMPASWDFFLARSHDGNVWLDC
HLYQYLDDLSKASTAVDVRALAKRSAKTLARERRSKLPVMVGKWSAALPYSDSVTTPEGR
IALERIYVSEQLAAYKDCPAWFFQTWKTSGRLPNWDARIALSSFERRLLD

Enzyme Prediction     

No EC number prediction in MGYG000000829_00234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	328	3.2e-42	0.9602649006622517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	7.44e-16	8	262	19	271	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	5.45e-07	54	298	20	248	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC04868.1	4.20e-158	8	350	2	343
SDR87855.1	1.43e-140	8	349	7	346
ADK68544.1	1.19e-134	4	349	3	346
QOY61077.1	8.54e-130	8	349	7	346
AKT48931.1	3.60e-126	8	349	7	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.11e-31	9	310	5	322	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.04e-31	9	310	5	322	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.82e-22	9	244	15	258	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
3N9K_A	1.49e-19	9	335	16	372	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	3.58e-19	9	335	11	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CRV0	1.33e-37	9	343	44	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
A2RAR6	9.77e-36	9	343	44	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
B0XN12	2.62e-35	9	343	44	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	2.59e-34	9	343	44	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A1D4Q5	2.54e-33	9	343	44	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000829_00234.