CAZyme Information: MGYG000000829_00946

Basic Information

• Species: UBA7748 sp900314535
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; UBA7748; UBA7748 sp900314535
• CAZyme ID: MGYG000000829_00946
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059		118811.03	4.7134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000829	2305677	MAG	China	Asia

• Gene Location: Start: 28356; End: 31535 Strand: -

Full Sequence      

MLSLDVWDDFGASADIRTWVDGKGEYIYHMDREEAGDHLHFTGSFEVPDPEILWYYFKIT
CSDGSVCWYGTKDGATSGEGELVWYEPSSWQISVYLTRKTLPLWYTKGIVYQIFPDRFAR
GADWCERVDAALSVKRNGPGRRLVEDWDTEPRYQKDASGDIVAWDFYGGTLSGIAEKLDY
LEALGVTVLYLNPIFEAASNHRYDTADYMKVDPMLGDTEAFQELCRAAEAHGMAIMLDGV
FNHTGCDSRYFNKYGNYPEVGAFQSKDSPYRSWYEIDDSGEYASWWGVGDLPDVREEDPG
YHELICGKDGVVRHWLRLGARGWRLDVADELPEDFIRDISSAARAERADAAIIGEVWEDA
SNKVAYGEPRHYLLGGELDSAMNYPFRGAVLDFLLNKVDAYETAARFEQLYENYPHDAFY
SALNLLGSHDRSRILTLLGGAPDPDTMDDNQRAAYRLSRDQMGLAKGRLWDAALLQMTMP
GVPSIYYGDEAGLQGMTDPYNRAPFPWGHEDKDCFNIYRNAIAIRKSLPVLVDGDFHPFA
VNQDVFGFTRSAGDESVMVLVNGGLSQRHEFEVQMQGEAVDDIVSGQDLEVHDGKVHVGL
WPLGTAVLYFHKAQMLDRPLEPGMGILCHITSLPNGGRPGTMGKPAHDFIDYLAAGGQRY
WQILPVNPCDRHGSPYAGLSAFAGNTALIEGTKEDLEKKAAAIKDSDPAFKAFCRKEEAW
LLPYATFRAIKHFEGGRAWQTWPAKYKKYSDKLLHDPSLAKEISYHEKRQFIFAQGWSEL
KEYAHSKNISLVGDMPMYVSADSSDVWSHPDLFSIDKDGNATSIAGCPPDQFSEDGQVWG
NPTYQWKRMAETGYEWWMQRFARACELYDYVRLDHFLGFSSYFSIPAGHSAKDGMWCFGP
GRALFEQAEKKLGPLPFIAEDLGSITPAVHALSASCGFPGLDVVQFSDQDVRQSYVPLHH
KVACSGTHDTQTLLGWAKSRFGEEDTPEFAERLLERVLATDAKVAIVPLQDVLGLDDTAR
MNVPGRADGNWCWQADAEDIKASLPHLKELAEKSGRAAK

Enzyme Prediction     

No EC number prediction in MGYG000000829_00946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	169	499	2.2e-129	0.9936708860759493
GH77	704	1038	2.1e-107	0.7105263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11338	AmyAc_CMD	0.0	108	536	2	389	Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14510	PRK14510	0.0	50	1056	59	1220	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.
PRK14508	PRK14508	5.36e-173	625	1057	8	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	8.06e-146	629	1033	2	455	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.35e-113	625	1059	31	528	disproportionating enzyme

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC03509.1	0.0	2	1057	27	1086
ADK68793.1	0.0	2	1057	27	1096
SDS02076.1	0.0	2	1056	29	1113
QOY60572.1	0.0	2	1056	27	1083
AKT48087.1	0.0	2	1056	27	1094

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X1I_A	1.46e-98	625	1056	8	499	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
2OWC_A	4.16e-98	620	1056	6	501	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]
1CWY_A	7.60e-98	620	1056	3	499	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
1FP8_A	1.06e-97	620	1056	3	499	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
5JIW_A	7.68e-96	620	1056	3	499	Crystalstructure of Thermus aquaticus amylomaltase (GH77) in complex with a 34-meric cycloamylose [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38939	2.19e-112	13	619	288	928	Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=apu PE=1 SV=2
P16950	5.31e-112	13	619	288	929	Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus OX=1516 GN=apu PE=1 SV=1
P36905	1.54e-106	4	622	294	934	Amylopullulanase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=apu PE=3 SV=2
P38536	3.80e-100	50	622	332	933	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P0A3Q1	6.49e-100	625	1044	7	482	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000829_00946.