CAZyme Information: MGYG000000829_00958

Basic Information

• Species: UBA7748 sp900314535
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; UBA7748; UBA7748 sp900314535
• CAZyme ID: MGYG000000829_00958
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1279		139448.64	4.3978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000829	2305677	MAG	China	Asia

• Gene Location: Start: 6581; End: 10420 Strand: -

Full Sequence      

MFGCMTRRHFVFGSAAAAAVAAGLSGLAGCKASGGAKKGSPQDVHAEDAQYFKSDYDYTQ
EGEQKLSDDQHALYRQLAEEGCVLLKNKNSALPLAKSDGKIMVFGNAGPAYIPQFDEAWK
EAGFDFDDACWQFYTDGTQNVVNVAVNENPWSSVEAAGFMGAASGVAIVVLGRRGHEGAD
NSHVEGRDYLAISAEEREMLDQVAALRRSGTFTKMVVLFNMTNTISWDSAPWDDAIDVVM
WCGSYFDPYFSKHERSYSVDPLVGVLTGAVNPSGRMPDTIYRDNHANPVMVNFGAIDADR
SHLSAGKDDEVQHEIDAWKPDVDKDKGSHWRRNYVYAEDIYIGYRYYETRYEDKVLGQGQ
AGDFDYAGYVAYPFGFGLSYTTFAYSNLAVQETDDGFDVSVKVTNEGKASGKNAVTVYVQ
SPYTAYDQDNGVEKAALKLAGYEKSDMIEPGASATVTVHVPIEELLSYDANAAKTYILDD
SEYWFSVGNGSHEAMNNILAAKGKGPEHGMTAEGNADLAALWSNPSFEDKAYSQAPTGAE
ITNLFDDVDPNKNKTMRKLNKVIWMSRSDWMGTYPKEATHLIYTDEVADLAKPVAYKAGS
GDAAKVKTHEFGKTGHETMLVDMRGKDYDDAGWEDLVSKLSYEEMVSLIADDQTELDVIG
KPATKDRDGSNGRAEVFAVSGIQGIPYGASAWRAATFNKGLNYQVGRMIGENMLHGSDAA
SMKVGLYGFSCNAHRSPYSGRNYEYYSEDPFLSGCAVSNEVKGLVDKGGVTFMKHFAGND
QETYRHGVPSWANEQTLREIYLKPFAIAMTEGGANGLMTGFNRLGMHWTGANAALLKGFA
EGEEGYRGLTLTDAYETDYMDTIDGILNGTHAWLNGTAYKNTDGVLLQDDYRSDPVIQDA
VFNTVHRILYVMANSLAMNGMTHDTALGATDQKSAMISGEDIPDKTVAFLPATMMTSFYE
DKTFSLNVMMSFLGSAFSDTGIWDYSDDGGLEMKYSDGTDIEISEKDGVFFWSKDVVSDL
LGPRTATGALSRYELTTAANKAMGTKFAVPDKPLYAVSFSNDNANVSGAAPETIEVGPGE
HFTMPDCPWSGRFQTFDGWDIDGKVYQPGDDVQLLGYADMAAKATWSDQVLVTATTQDTY
KYSFIQKPTVPLILRCNGTLRLDALNLVSCTGTWTVAGAGAEATLALLNEAGEPVAARID
NGAVTYVQDGFYYDWGQPDVGYGSGVFYTTYTHRIPVEDFLDAYNSTFGTSYTSLAVKTG
TASFAEQSDPQAPSLASAW

Enzyme Prediction     

No EC number prediction in MGYG000000829_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	666	861	3.7e-33	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01915	Glyco_hydro_3_C	4.12e-16	83	289	2	198	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	2.75e-14	694	858	90	253	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	4.72e-14	75	470	388	735	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	9.65e-11	694	854	95	255	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	9.40e-08	417	491	5	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81839.1	2.29e-187	44	920	51	944
QOS39524.1	1.14e-163	43	931	53	975
QHB23095.1	6.14e-162	47	930	70	944
QEI30583.1	6.14e-162	47	930	70	944
QRT29488.1	8.59e-162	47	930	70	944

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.39e-57	75	879	41	768	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	9.80e-25	694	915	88	307	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.99e-24	694	915	88	307	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.36e-22	634	909	7	279	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.48e-20	634	909	7	279	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	1.86e-49	163	853	124	696	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	4.80e-41	62	865	19	783	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5BFG8	1.68e-29	629	913	7	287	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	9.45e-22	634	853	3	222	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A1DNN8	1.01e-21	634	857	15	237	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000008	0.000154	0.999820	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000829_00958.