CAZyme Information: MGYG000000829_01957

Basic Information

• Species: UBA7748 sp900314535
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; UBA7748; UBA7748 sp900314535
• CAZyme ID: MGYG000000829_01957
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000000829_61|CGC1	54160.97	4.8781

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000829	2305677	MAG	China	Asia

• Gene Location: Start: 8314; End: 9753 Strand: +

Full Sequence      

MGFPEGFLWGGATAANQCEGGWNEGGRGLANVDVAPAGPDRLAVVSGEKKMFGFDADHYY
PAQTGIDMYHTYRDDIALFAEMGFKTYRCSIAWSRIFPEGDEEQPNEEGLAFYEDLFRCC
QEHGIEPLVTITHFDCPMHLIEAYGGWRSRKLIDFYKNLVTTLFTRYKGLVHYWLTFNEI
NMIFHLPWMGAGIAFEEGEDKEAVEWKAAHHELVASAWATKIAHGIDPSNKVGCMLAAGA
YYPFSCRPEDVRQAQLDTQHELSLIDVQARGAYPAWVKLMLERKGIDLGMTDEDRRILAE
NTVNFVSFSYYSTRCSAAPTTDAPRTQGNAFAGAMNPYLEKSQWGWAIDPLGFRTTMNEL
YDRYQKPLFVVENGLGAKDELVPDGKGSYTVEDDYRIDYLRQHIQVLRDTIEEDGVPVLG
YTTWGPIDLVSAGSGQMSKRYGFIYVDRDEEGRGTLKRYRKKSFGWYKKVIATNGADLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	475	9.3e-137	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	478	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	479	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	479	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	479	4	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.57e-172	1	478	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68819.1	5.35e-276	1	478	1	475
QWT17213.1	4.47e-263	1	478	1	474
ATP54514.1	2.67e-262	1	478	1	475
QIA32972.1	5.13e-260	1	478	1	475
AEB07701.1	1.35e-257	1	478	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.95e-190	3	478	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.19e-164	4	478	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.38e-164	4	478	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.45e-160	4	478	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.13e-159	4	478	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	5.98e-205	3	479	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.76e-188	3	478	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	9.62e-177	1	479	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	6.16e-168	3	478	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	9.30e-164	3	478	4	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000829_01957.