CAZyme Information: MGYG000000836_01129

Basic Information

• Species: UBA10281 sp000437515
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp000437515
• CAZyme ID: MGYG000000836_01129
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		80631.5	4.6936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000836	1764500	MAG	China	Asia

• Gene Location: Start: 26688; End: 28826 Strand: -

Full Sequence      

MWIKRQGDFNGEARLPAFVKRFDLNGKIKSCRLKITATGIFSVKFNGKKIGDYFMPGWSN
YKKYVNECEYDLTNDVGETNEISVLLADGWYAGNLGYNVGNAVYGREKRLRAEITTEYEN
AGTQTIETDETWDTYSSNIVCADFFDGEAIDFTHEEFANGQKAEVCDFDLKREPYLYEPV
RVIEKIIPEIIYRDENRIRLDFKKNFAGVISFTAKGARGGKVIVRFAETLNADGTLYTEN
LRRAKCTDELILSGGYDVFDPEFTFHGFRYAEISSDSEFTATDIIGKELSQNINYGGRFE
CSDDIINGVYKMASNGQKSNFISIPTDCPQRDERLGWTGDAEVFCNSAMFNADCEKFFAN
YLKLIRTDVLPDGRIPSFAPFFVPVADNTAGVPGWGDAITVIPYFHYLHYKDERIITDNL
PYADKWIEYYLSKSENYLTKITNNFGDWLSVDGKTDVDVINQCFFGYSVKIVAKMHAIIG
DNAGETLYNGIYEKAREAFRNAYFDGERVKSDTQTAYAFAYAAGYITAEETRERLKTVIA
ANGDKLTTGFIGCRFLLPALCDVGESELAYKIITQTGYPSWGYMLENGATTVWERWNGYT
VENGFENPEMNSFNHYSLGSCVEWLYSYVLGIKLSADKPVCVKPTFFEKLKYAQGCYAGK
NGNVYIKIENKNSAVAVEITADDGAEYTYDFSDREILSAERRGKTEIITLKK

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	194	684	3.5e-143	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.48e-109	297	629	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.68e-29	26	184	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.89e-27	200	285	10	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI42913.1	8.06e-148	2	684	80	796
AFC30614.1	7.38e-147	2	684	125	841
AFH62916.1	3.15e-145	2	684	125	841
QNF26773.1	3.19e-143	10	685	138	861
ASA21372.1	3.90e-141	2	639	123	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.43e-123	27	672	315	975	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	4.16e-90	13	686	174	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	7.79e-83	18	632	134	778	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.98e-123	27	672	315	975	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	5.59e-113	16	679	174	866	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.74e-111	16	680	170	867	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	5.77e-55	18	646	187	861	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000836_01129.