CAZyme Information: MGYG000000837_01350

Basic Information

• Species: Dysosmobacter sp900544105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900544105
• CAZyme ID: MGYG000000837_01350
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		59545.61	4.4708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000837	2171635	MAG	China	Asia

• Gene Location: Start: 4940; End: 6559 Strand: -

Full Sequence      

MKRHFGKWLTAAALAVGCTVMTANAFADTDGHWAESAINKWSGEYGIIQGYDDGTFRPDK
TITRGAFAGILDRFLHFQNASPTNTFSDTAGTYWEDAILKLHASGIYLGNQGAALPSSTI
TRQQAVAMIGRAFRIAPETAAPDYTDTARIAEYAMAYVGEFEARGYLTDSAAGTFRPTDP
ITRAELINILNNMVDTLVKETTTVTEDVSGSLLISAADGATLKGIQVGGDLILAPGVTKD
VTLVDCVIQGNIRNYGTGEVRFEAPQITPESTATKPSEVYKPGATLDRTLEYNGKTVPIY
RDRPLNVFSDVDFIWTDEKNENQRRLEYLGGEFRTRYGIDASSFQGEIDWDAVADDDIDF
AMVRVGFRGTGTGSLNTDKYYEQNIRGAMRAGLETGVYFFAQAVTVEEAIEEADYVISLL
DGLDINGPVAYDWEMHDSTYRVYGTSPEMATACAVAFCQRIKDAGYTPMVYAGTYVTYMK
YDQGALADYLSWYPEYKSEKSEKLCPTLVYHMDYWQFSSTRAVAGINGRVDMNIQFIRR

Enzyme Prediction     

No EC number prediction in MGYG000000837_01350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	339	526	5.4e-40	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	9.05e-71	338	536	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	3.31e-28	337	534	1	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	5.91e-19	339	526	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	1.95e-18	338	533	65	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
cd06415	GH25_Cpl1-like	2.49e-18	337	532	2	195	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCI60549.1	3.68e-231	2	539	4	546
BCK85948.1	1.72e-230	8	539	9	550
QUO37824.1	3.58e-222	9	536	10	556
BAK99312.1	5.68e-193	4	537	3	542
QNL45744.1	1.18e-169	12	539	15	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	4.00e-06	338	533	7	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	1.48e-11	26	195	1682	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	8.19e-10	26	195	908	1082	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
Q06852	2.16e-09	22	142	2141	2273	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
P38537	1.74e-08	9	195	19	207	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
Q06848	4.22e-08	30	146	290	412	Cellulosome-anchoring protein OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=ancA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000582	0.928269	0.070279	0.000356	0.000266	0.000223

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000837_01350.