CAZyme Information: MGYG000000837_01777

Basic Information

• Species: Dysosmobacter sp900544105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900544105
• CAZyme ID: MGYG000000837_01777
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000000837_77|CGC1	52109.17	5.4277

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000837	2171635	MAG	China	Asia

• Gene Location: Start: 7424; End: 8815 Strand: +

Full Sequence      

MYYEDNRVKDLKVAYIGGGSRGWAWGFMMDLATDAQMEGTVALYDIDHEAAEHNEIIGNK
ISAHPDAVSHWKYTVADTLQQALTGADFVVISILPGTFDEMESDVHAPEAYGIYQSVGDT
VGAGGFMRAMRTIPMYVTIAEAIRDYSPNAWVINYTNPMTLCVRTLYHVFPKIKAFGCCH
EVFGTQTLLTHILDEELGLKDVARQDIKVNVKGINHFTWFDKATYKGMDLFPIYRKFAEE
HYESGYEYGDTNWMNSSFACANRVKFDLFLRYGCIAAAGDRHLAEFMPGKTYLESPEAVR
EWKFGLTTVAWRKNELQERLARSRRLRTGEEPIEIKPDGEEGHLLMKALLGLGDLVSNVN
IPNHGAIANLPWDAVVEVNALFSRQGVQSVNAGPLPANILPLVARHVYNQENTLTAALTC
DRTLGLTTFMNDPQVTLNWNQGKELFDTMLHNTRAYLPKEWNA

Enzyme Prediction     

No EC number prediction in MGYG000000837_01777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	1.2e-56	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	3.18e-155	11	450	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	7.49e-103	9	459	2	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.23e-70	12	458	3	428	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.35e-54	12	195	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	1.36e-47	11	457	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA52691.1	3.28e-228	8	461	9	463
QUC66877.1	1.82e-227	8	461	8	462
QTE72492.1	1.05e-226	8	461	8	462
QTE73479.1	1.05e-226	8	461	8	462
QTE69428.1	1.19e-223	7	463	8	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	5.51e-159	8	450	3	436	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	2.52e-20	9	459	3	436	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6DUX_A	1.44e-19	6	396	2	379	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]
1S6Y_A	3.62e-19	5	459	2	439	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	1.30e-18	1	416	18	421	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	6.00e-213	1	457	1	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
A9KTB9	1.29e-207	1	462	1	465	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
D3T426	8.00e-184	1	461	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	2.63e-163	8	450	7	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P06720	2.15e-40	12	458	6	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000837_01777.