CAZyme Information: MGYG000000840_00153

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000840_00153
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800		90325.34	9.4464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000840	2579152	MAG	China	Asia

• Gene Location: Start: 161823; End: 164225 Strand: -

Full Sequence      

MARYINGLYSLYFRRNEMSLASSWRRTCAASLLLASLALAQAAYAADPQASQSTQSGESP
LIRPIPHRFVPVTIAERLQSLNTADGEVLIIEESAAAVDPAEVVLSVDRAFAREPVLLES
GLTEAAADEATDAAGRVTAELLNEPVVDPLDVALYAVPPEPLDNVFLDARKAYVRGDLAR
LEKLAPILSTHLLKDYIELWTLTLRLKKEPDSPEATFALERFIELHPEDYIGERAALEYL
QFAAERMNAERFDFFYKRLAWNKTDPEIAAWHAIYTLGTPDTKPSLGALNDAKSLYRDAS
APHSKAYRSLGDAIVARDRSWAWPRVVILLQHGRWNEVKYALRDVPRPELPASLSRLHEI
IDRPNTWMRRQKDLSKLPARLAVFAALRMSHSSPERAARIAEKCLDKKADAFWRSLVWMR
IGYEATVNLDDRAFAWYRKAGRAFTQRPQLVVNAEQLQAWQARAAMRAGNWYSLNKIIDA
MPASLRNEETWIYWRARALSARGLSGEAAKEFERIANRLTFYGRLAADAIRRPYPVGKPP
LEPPRSDEINAWGSNPSIARARAFYRMHLYVEGHREWNWAMRGLKERDYIVLAAYAKENL
LIHRMINTSQRSGEKTVDIAQRYPMPHFSLFSHVCSTQKIPLAWVYGLIRQESRFIPTVS
SSVGAQGLMQVMPATAKWLAKKLGITAYDREHLTSLEINLVLGTAYLNILYSDLNSSYVL
ATAAYNAGPARARSWRAALEKPMESAIFIETIPFFETRTYVKNVLANTLTYSLLDGDPIK
NFTQFISTVQPSSATNPNIP

Enzyme Prediction     

No EC number prediction in MGYG000000840_00153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	643	768	1.2e-22	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	5.06e-64	622	774	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK11619	PRK11619	2.32e-42	463	784	320	637	lytic murein transglycosylase; Provisional
cd16896	LT_Slt70-like	7.66e-39	643	767	20	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	9.30e-31	643	767	2	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.53e-30	491	784	3	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA54820.1	5.99e-277	69	800	57	790
BBF22242.1	9.59e-272	64	800	60	794
QQS89613.1	9.03e-267	59	800	53	803
QRJ64322.1	3.68e-111	150	778	10	623
QWT46978.1	3.39e-103	163	794	41	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.09e-54	390	778	181	562	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.24e-54	390	778	185	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.50e-54	390	778	191	572	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.68e-54	390	778	195	576	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.97e-54	390	778	201	582	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.80e-39	461	777	318	631	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.80e-39	461	777	318	631	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.69e-36	164	771	35	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	6.71e-21	474	774	283	575	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31976	5.54e-09	599	767	1394	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.319363	0.635811	0.036445	0.005479	0.001923	0.000970

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000840_00153.