CAZyme Information: MGYG000000840_01609

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000840_01609
• CAZy Family: GH102
• CAZyme Description: Membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000000840_19|CGC1	44177.35	8.2492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000840	2579152	MAG	China	Asia

• Gene Location: Start: 5180; End: 6376 Strand: +

Full Sequence      

MNRRFSLRAAALSLSALLLAACSTTQQQPEPPQETVTAPHFEPDSFAAMPAVSQEDWLAA
FNAFRTSCSSLRANSPFHNVCTIALQTPKELAQAFFEANFAPWRVSLGRFEAGELISRDE
TGLATGYYEPLLRGSRTKTPPYVYPIYGVPDDLLVIDLAELYPSLKGLRLRGKLEGRRVV
PYDDRAAIQKRTDMDRWAIAWVDDPVDAFFLQIQGSGRISLPDGSFMRVGFADQNGYKYR
AIGNWLVKNSELKAHELSMQNIRAWAKKNPTKVRDALAQNPSFVFFEERTGHPELGPLGA
QGVPLTPLASVAVDPKHWLLGTPLMLEVHQTRPALDFVRPVVAQDTGAAIKGLIRVDYFW
GFGDEAGREAGRQRSDASLWVLVPSGLKPEDIRPGRGR

Enzyme Prediction     

No EC number prediction in MGYG000000840_01609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	132	287	1.2e-57	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03562	MltA	8.73e-102	53	286	2	230	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
COG2821	MltA	8.65e-96	37	390	6	371	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
cd14668	mlta_B	3.16e-81	132	289	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	3.11e-71	131	286	1	152	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	9.57e-49	123	382	117	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22454.1	1.60e-180	7	393	6	394
QDA55021.1	8.16e-166	8	395	16	397
QQS89395.1	2.08e-159	29	394	38	398
ANU66434.1	8.40e-148	15	393	16	400
QQQ97583.1	8.40e-148	15	393	16	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESJ_A	2.19e-88	22	387	2	362	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2G5D_A	3.90e-79	48	390	49	419	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	7.43e-76	39	390	46	419	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
6QK4_B	3.95e-75	36	385	20	347	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
3CZB_A	4.96e-50	45	385	11	342	Crystalstructure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15],3CZB_B Crystal structure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	1.06e-32	125	382	119	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	1.06e-32	125	382	119	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q8K9A7	3.67e-25	125	382	127	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1
Q9KPQ4	5.18e-25	111	390	98	365	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
P57531	2.55e-20	125	382	119	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000074	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000840_01609.