CAZyme Information: MGYG000000842_00785

Basic Information

• Species: Collinsella sp900540845
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900540845
• CAZyme ID: MGYG000000842_00785
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000000842_7|CGC1	88734.43	5.469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000842	1846287	MAG	China	Asia

• Gene Location: Start: 12193; End: 14637 Strand: -

Full Sequence      

MERVSIEDKARLLAGASHWRTYGDERLGVAALTLSDGPHGLRKQEGSSDHLGIAESVPAT
CFPSAAALACSFDPDLIEEVGAALGEEAANQGVDVVLGPGVNIKRHPLCGRNFEYFSEDP
VVSGEMGAAMVRGIQSRGVGACLKHFAGNSQEHARMVADSVIDERALRELYLAPFEYVVK
SAHPCTIMTAYNRLNGEYCSQNRWLLQDVLRDEWGFDGAAVSDWGAMSSSVASVHAGLDL
CMPGPRRDHASAIAEAVRSGELGEEDPDERVEALARLTSRIKPKCPPVATADKETFYRSH
ADLARRAAAQSAVLLKNEGTLPLNTTQTVAVIGAFARLPRYQGSGSSRINPKFLDNIWYR
IEQRGFAATYADGYEPQMGETNEQLLAEAERVASDADVAVVVAGLPARYESEGFDRKLMV
MPRGHVELIERVCAANPRTVVVLQGGAPMEMPWHDKPAAILLMYLSGCQGGGAAVDVLAG
DVNPSGKLAETWPQRLADTALGSTFPDMDREVHYRESVFVGYRYYDAVGVDPAFPFGFGL
SYTQFEYRNLEVNHGRVRLLVKNTGVRAGADVVQLYMAPSAGVMPPPRPPQKLVAFRKVH
VEPGEERAVEFSLGVEAVRSWDASAHEWVVCAGAYELRASASSRDVRLRLQLEVSEDGVV
EVARREPPRAASDFPQHNRPIAVPSIYEKPHAGCFAEPEAESAFTQLYGSELPGPRSVVP
FTVDSTVEDMAASWFGRRMFRIIDWVVAEPASKMDHIQRTMMREMAADMPLRSLTTSGVP
LGAVEGFVGMLNGHYLTGFARVVRELTRAISSTR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	24	243	3.3e-72	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.08e-84	60	647	118	758	beta-glucosidase BglX.
COG1472	BglX	1.12e-73	26	336	57	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.37e-59	312	522	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.97e-57	26	613	78	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.22e-43	24	277	61	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82048.1	4.29e-225	3	793	9	787
QQO08873.1	5.06e-220	3	660	14	668
AGS53403.1	9.26e-216	3	807	11	792
QOV18429.1	1.96e-214	1	778	12	774
AEV59720.1	4.15e-210	1	794	20	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.67e-207	1	665	9	677	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.18e-161	4	658	12	667	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.63e-145	1	657	8	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.52e-144	1	657	8	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.91e-110	1	646	10	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.46e-206	1	665	9	677	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.40e-159	4	658	12	676	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.76e-159	4	658	12	676	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BB53	2.16e-126	1	654	10	830	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
Q2U8Y5	1.64e-125	1	646	10	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000022	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000842_00785.