CAZyme Information: MGYG000000843_00302

Basic Information

• Species: Lacticaseibacillus sp900540605
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus sp900540605
• CAZyme ID: MGYG000000843_00302
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1309	MGYG000000843_3|CGC1	140627.15	4.9944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000843	2470970	MAG	China	Asia

• Gene Location: Start: 54987; End: 58916 Strand: -

Full Sequence      

MKKRHLISAGVLTLVLLATGAAHVQADDNLNLALNQPVQFSGVEGDKKADGSWVYPQFTG
DKAVDGDESTRWSAAKQDDQWLTVDLGATKTVSEIDLDFHAESPEYEVLVAKDDQNYQPV
YTVKNGTQGTVINRKITLTQQQVRYIKYHQQKQFLNSQNQQYYGSSINELKVFADEQRLT
SLSLDAASKTVSVGNSTSFTYTGKPTDFTPAASAVTWSSSDPSVATVDAKGQVTGVKAGK
ATITAAVANSNVTATAEVTVAAEREEYVQMRQRWRDRLIATNPDLSDPNVKAYLTDLAAQ
SQTVWDTMDRSATRSRLWPAVAGESASADITTVFTKIKTLTLGYYNPLSKQYHDQAVYDA
IISAINFMITDQKYNGTYWSDNWWDWQIGAAQQLDDTLMLLYNDLNQKDHATLVKFVQPL
LGYDKDPNVRWPNYVATGANLTDVSITVLATGLLLEDDSRVALVQENLPKAMGLVTVSDG
IYADGSFVQHTNIPYTGSYGNEMIKGIARVSSVLVGTPWAIGEDQFSSIYTLLDKGFLQG
MVNGRMPSMLSGRSISRTPGTNSETTELETGKETIANLSLIADATPAPLKGKIYQAIATW
VAQVGSRYNFYSNPRDYAALTGLKTVLDSTTAQANDVDSLNIYGSMDRVLQKTADYSVGI
AMYSKRIANYEAINDENVRGWHTADGMLYLYNNDYDQFGTGYWPTVDPYRLPGTTVDTAP
LADGAGASTLSPQAWVGGASDNKIATVGMALNKVNQGQNLKAMKSWFLLDGQIVNLGANI
NGSTTADIETIVDQRQIDPATAKVTVDGQPFANQKTVSQWANLNAADPKNNVGYIIAPNN
DPVDISQATRKGSYSDINKTFPNDTIYTKTYLTLAAMHGKTVTNGTYEYVTVPGATDAQV
AALAKNPSYEVLSNTDQLQAIQTKNEILANVWTRANQLGDLVSIDNTAAVLIKDLGNNRY
QITASEPRQTGATVNFTFNYPVSLVDKADTTFTAEDNQLHFATAGLAGASQTVTVQLAVP
TDKTALTKTIAKAQSLSADTYTPSSFAKVQAALTAAQTVAGNEEASQADIDAADAALTAA
VADLVEVAEKESLTNAIAAADKLKASNYTPSSWQAMQKVLAAAKQVAGDLDATQDAVNDA
TAQVTASVKALNKVADTIALQAAITVANKYAAKNYTDATWQALQAAIKAGQALTGEATQT
EVDAATAKINAAIKGLVKVTATVDQETDQKPIKKPNPQPTGQTDQPSGKQPNPAQKPQTP
AKASQPAAAKTKATKRSLPSTGEVTFAALSVLGMSLLAGVALIWRKHRA

Enzyme Prediction     

No EC number prediction in MGYG000000843_00302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	641	897	5.2e-84	0.9884169884169884
CBM32	52	171	2.7e-21	0.9112903225806451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	0.0	266	967	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam08124	Lyase_8_N	2.43e-90	274	599	1	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02278	Lyase_8	2.05e-84	643	896	4	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02368	Big_2	4.78e-12	180	258	1	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
pfam00754	F5_F8_type_C	4.98e-11	55	170	9	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC21778.1	0.0	257	1126	68	937
QPC12370.1	0.0	257	1126	68	937
EKP96241.1	0.0	257	1126	68	937
AWR91247.1	0.0	257	1126	68	937
EEQ65827.1	0.0	257	1126	56	925

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	8.20e-94	265	999	4	722	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
1J0M_A	3.11e-93	265	969	2	699	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]
2E22_A	2.07e-92	265	969	2	699	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
2E24_A	2.84e-92	265	969	2	699	ChainA, Xanthan lyase [Bacillus sp. GL1]
1X1H_A	2.58e-91	265	969	2	699	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	2.24e-90	260	969	22	724	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	2.73e-79	260	951	284	971	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	3.90e-77	261	968	246	974	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	5.21e-60	266	1001	48	803	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
P0CZ01	4.39e-59	272	1015	44	796	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.998876	0.000273	0.000201	0.000166	0.000148

TMHMM  Annotations     

start	end
7	26
1282	1304