CAZyme Information: MGYG000000843_01108

Basic Information

• Species: Lacticaseibacillus sp900540605
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus sp900540605
• CAZyme ID: MGYG000000843_01108
• CAZy Family: GT2
• CAZyme Description: putative glycosyltransferase EpsJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		26672.2	9.6823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000843	2470970	MAG	China	Asia

• Gene Location: Start: 56398; End: 57120 Strand: +

Full Sequence      

MMTTTLTLIIPTYNLGSYFAGMLGALQRQTRPFDLWLVDDGSMDETASQAEAFTRGIPNF
HYFAFSRHQGVSTARNYGLARATTAAVAFVDGDDLIADDFVQVLATAMSPAVSAVAVGYR
WFRTPVVAKGEQRLDQAAMFEQVSHHGTAIGGYVWNKAFRRAAITAANLQFDPTLQLAED
YWFTASFVARTPGPYVYLPAVRYTKRNRPNSTIHRAGFQARAQEDAVFERIRQLRAGLAR

Enzyme Prediction     

No EC number prediction in MGYG000000843_01108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	119	5e-24	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	5.20e-19	13	187	6	147	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.65e-18	13	122	7	119	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	2.18e-13	13	123	12	118	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
PRK10073	PRK10073	2.78e-13	13	184	15	196	putative glycosyl transferase; Provisional
cd02525	Succinoglycan_BP_ExoA	9.38e-10	13	181	9	184	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVK99538.1	4.55e-87	6	234	3	231
ARD33125.1	6.42e-86	6	235	6	236
AGP70442.1	6.42e-86	6	235	6	236
QJZ29346.1	6.42e-86	6	235	6	236
QQN32131.1	6.42e-86	6	235	6	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	9.38e-06	5	119	14	130	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11290	1.55e-10	3	217	5	229	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
D4GYG7	1.38e-07	2	93	1	98	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
P46918	2.26e-07	7	98	11	105	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1
P46917	2.45e-07	7	218	3	223	Minor teichoic acid biosynthesis protein GgaA OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaA PE=3 SV=1
P33700	2.81e-07	4	181	7	194	Succinoglycan biosynthesis protein ExoU OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoU PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000843_01108.