CAZyme Information: MGYG000000843_01464

Basic Information

• Species: Lacticaseibacillus sp900540605
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus sp900540605
• CAZyme ID: MGYG000000843_01464
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000000843_14|CGC4	42485.38	4.7697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000843	2470970	MAG	China	Asia

• Gene Location: Start: 61154; End: 62302 Strand: -

Full Sequence      

MTMELGNEAVNEYAALLAGKRVGLVTNFSGLTATFKPTYQVLNELSAGVTKLFTPEHGLH
GIAGAGESVESYFDNALNLEVVSLYGSHRAPAGDDFTDIDVLAFDIQDIGVRYYTYIYTL
LESMQAAAQANMPVLVFDRPLPLGRQQPVGQAMTHDYFSFVGLLPLPNRYELTIGELAAW
IKDHLTPQLQLTVAIMRGWDASRNLLDNGLPWVAPSPNLATLDALRLYPGLCLLEGTNVS
EGRGTVKPFEQFGAPWIDANQLANCLTETAAQDDHLRFQPVWFEPLASKHTHEICQGVQV
HIMDNAFNPLTLGYNVLKAMMTLWPDRFTMDLVSPVIGTKHRFIEYLAGRQLQTIADLDA
GIELSGVTDHKFWQESRAYYRY

Enzyme Prediction     

No EC number prediction in MGYG000000843_01464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	22	356	3.5e-108	0.9408450704225352

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	1.50e-132	23	382	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	2.67e-102	12	334	36	358	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI72823.1	4.23e-168	3	359	2	357
AXN36644.1	1.22e-143	4	382	5	381
QNN73415.1	6.62e-101	17	357	20	356
QGG54321.1	1.14e-89	1	382	1	382
QJC50316.1	3.23e-89	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	5.09e-56	17	331	28	345	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	1.50e-41	5	255	8	257	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	6.56e-80	12	328	47	363	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000843_01464.