CAZyme Information: MGYG000000843_01704

Basic Information

• Species: Lacticaseibacillus sp900540605
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus sp900540605
• CAZyme ID: MGYG000000843_01704
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000000843_17|CGC1	37651.89	6.383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000843	2470970	MAG	China	Asia

• Gene Location: Start: 51324; End: 52343 Strand: +

Full Sequence      

MNYIISPLQAASDQAVVKPKEDVAHYLQQIGFQPLWYNRFIKFEGDGDWAGRIEGMLGPV
QAGDVVIYQTPTYADITIEKYIIEAVHQRHAKIVAFVHDVEYLRYPELYPKVEWLDYLNS
FDVVMVSTTPMAAAIKADGVKRPIIISGPWGYVEPMTYHQPSFSRSLHYAGNLMKWKSGF
LRHVPASLDVQVYGSENGQTNLSYPLGPGVTYHGTMSQAQLGLKLTHGFGLIWDEDDQGH
YAAYARINQAHKFSLYLALGLPVIANRESAIGAYIEQNQVGLVVDHLNQLPDVTAAQTEA
TYGPLVDQVKALTALIRAGRHTQLAALKAVLAAHDITSE

Enzyme Prediction     

No EC number prediction in MGYG000000843_01704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	5	328	2.2e-78	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	5.94e-72	2	323	3	323	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ68263.1	2.29e-117	1	332	1	331
ADK18320.1	1.73e-114	1	332	1	331
AGP67956.1	1.73e-114	1	332	1	331
QOP55092.1	4.94e-114	1	332	1	331
ARY91177.1	4.01e-113	1	332	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	4.16e-27	30	333	33	329	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	4.88e-20	30	323	33	319	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	5.30e-20	30	323	41	327	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU1	4.64e-33	20	331	21	330	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0H2UR93	2.54e-29	11	323	12	323	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	2.20e-26	30	333	31	327	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
B3XPQ7	2.14e-24	52	330	54	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	6.13e-24	20	330	26	334	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000843_01704.