CAZyme Information: MGYG000000847_00299

Basic Information

• Species: Acidaminococcus sp900538365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900538365
• CAZyme ID: MGYG000000847_00299
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		38191.29	6.9435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000847	2084328	MAG	China	Asia

• Gene Location: Start: 50040; End: 51065 Strand: +

Full Sequence      

MINFHRYRWVFLLAFMALLSLVGPTREGMSAHLSLSAWITYWNREQGEKEAQVLQDRLQD
ISYFAAYFNDRQELVFPEGFQKPPLAADRAYLTIVNDVVFPDGTSRLKDTEQLASLLATG
ERRRKHAASILDLAEKHGFSGVEIDYETLWKRGDTRLQEHFLRFLSELEKQASRRHLKVR
AVLEPSAPFSAPFPKNIEYVVMAYNLHGPHNGPGPKADLAFIRRTIGKMNALTGEASLAF
SLGGAVWKDGKEGRFLSEQAAAALAEQYGKVPQRDAASAALHFSYEADGHTMTVWYADVT
TLEAWIQAAMEAGYPHVFLWSLGGSRDLSHLASSKAEGGKE

Enzyme Prediction     

No EC number prediction in MGYG000000847_00299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	109	326	4.4e-20	0.7162162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	4.18e-28	92	324	63	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	2.41e-20	89	323	60	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
pfam00704	Glyco_hydro_18	4.19e-15	109	324	75	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.24e-11	114	231	83	212	Glyco_18 domain.
COG3858	YaaH	2.94e-11	112	323	180	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ22057.1	1.02e-218	1	341	1	341
AJQ26843.1	2.51e-73	36	331	43	343
AEB99159.1	5.00e-72	8	331	2	337
QDR79732.1	2.24e-71	18	331	18	343
AIF51322.1	6.30e-71	36	331	43	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.165228	0.817402	0.015673	0.000451	0.000408	0.000802

TMHMM  Annotations     

start	end
7	24