CAZyme Information: MGYG000000847_00849

Basic Information

• Species: Acidaminococcus sp900538365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900538365
• CAZyme ID: MGYG000000847_00849
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000000847_13|CGC1	35622.82	9.8543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000847	2084328	MAG	China	Asia

• Gene Location: Start: 34791; End: 35738 Strand: -

Full Sequence      

MDEIAIVLACDDRYAQHAAVAAASMLLCHKGSRPLHFYLFDDGITGVKKEMVERTIKDLK
GLVTFIDTKGITVDAYTSGHIHKAAYLRLLIAKLLPLAIAKALYFDTDLVVKDDVAKLWD
FPLDGHPVGAVKDFGIMASSRMRRQKAESLDLPLGAPYFNSGVMIMDLAAFRKEGYGEKV
LQCVTSYAYRHHDQDGLNKVFMGNWAILPLRWNVIPPVFGMPLKVLKKGALRLEAIEALK
DPAVIHWAGRYKPWEFVQSEHFNRIYYEVLKKTAFRDAPMPQPGDMTGKSLWRQEMRIRL
GKFWTRLLGGAKKTL

Enzyme Prediction     

No EC number prediction in MGYG000000847_00849.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	256	9e-52	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	4.82e-62	4	256	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	3.93e-40	6	254	2	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	2.23e-38	4	277	3	268	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	5.42e-25	4	255	1	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd06429	GT8_like_1	9.14e-10	86	254	102	240	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ21319.1	1.95e-218	1	309	1	309
ADB46896.1	6.22e-131	1	307	1	308
AXB82129.1	4.50e-119	1	309	1	310
AXL22107.1	4.09e-117	1	308	1	309
QNP77233.1	1.66e-84	4	307	5	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1G9R_A	1.58e-18	6	254	3	252	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	1.58e-18	6	254	3	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
6U4B_A	2.72e-17	4	263	302	577	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	3.64e-33	2	281	4	282	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P27129	6.50e-14	83	299	107	312	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
Q0V7R1	6.83e-14	86	254	146	315	Probable galacturonosyltransferase-like 3 OS=Arabidopsis thaliana OX=3702 GN=GATL3 PE=2 SV=1
A0A0H2URH2	7.31e-13	6	267	5	242	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
A0A0H2URH7	2.00e-12	5	273	304	547	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000847_00849.