CAZyme Information: MGYG000000847_01850

Basic Information

• Species: Acidaminococcus sp900538365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp900538365
• CAZyme ID: MGYG000000847_01850
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28896.53	8.2336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000847	2084328	MAG	China	Asia

• Gene Location: Start: 6368; End: 7138 Strand: +

Full Sequence      

MKKLLFILTLILGGLLWYVMVPAAPTASAGGPTLMESFSYPYLGKKLPRPIRLCYLAYHM
KDVAQGRIDKSDWINLDSMPAYLPQALIATEDRRFYSHIGIDPSAIMRAILVNLQYDEVA
QGGSTLTQQLVKNNLLSPERTLERKLWEAGLALIVEARYSKEEILEMYFNTTFFGNHSTG
IRSAARNYFGIEPKQLSLMECAVLAGLPNAPTDLNPYNDMEACRRRRDLVLENMHDQGFI
TGNQLNHAKKADIVLR

Enzyme Prediction     

No EC number prediction in MGYG000000847_01850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	69	235	6.9e-63	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	7.69e-82	70	235	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.25e-76	73	255	4	186	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.97e-76	65	256	70	262	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	5.40e-68	76	256	72	252	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.13e-53	74	256	69	251	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ23280.1	2.29e-177	1	256	1	256
ADB46989.1	7.02e-80	1	248	1	256
QTV77901.1	3.12e-62	48	255	61	268
BBG64464.1	5.42e-58	48	254	63	268
QNP76977.1	5.42e-58	48	254	63	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.10e-51	68	248	17	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	4.40e-51	68	248	17	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	3.09e-39	74	254	43	223	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	3.60e-35	70	253	26	209	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	7.34e-34	70	253	35	218	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	2.39e-47	5	253	44	278	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O66874	1.30e-46	32	256	33	248	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P02918	6.12e-43	74	253	69	248	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1
Q4UK08	7.77e-41	40	256	37	255	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1
Q9ZCE9	6.87e-40	40	256	37	255	Penicillin-binding protein 1A OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.017736	0.980323	0.000881	0.000361	0.000313	0.000343

TMHMM  Annotations     

start	end
5	27