CAZyme Information: MGYG000000852_00709

Basic Information

• Species: Prevotella sp900545525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900545525
• CAZyme ID: MGYG000000852_00709
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		35054.09	9.5511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000852	2918004	MAG	China	Asia

• Gene Location: Start: 25513; End: 26418 Strand: -

Full Sequence      

MTETKKEKGPLFSILIPSWNNLEFLKLCLKSIERNSCYTHEILIHVNEGSDGTLEWVRNK
GYKYTHSIENIGVCWALNSLRTLVTTEYIVYMNDDMYALPQWDSVLLKTIQSIGHKRFYI
SASMIQPQAHPNRKISVGVADYGMTPETFREDDLLKHYNDIYIPNWKGSTSPPCIVHRDI
WDTVGGYSVELSPGMASDPDFSAKLWLAGIREFKGIGASRVYHFMSRSVGRVKKNRGSLQ
FLRKYGITIRTFQNDILNIDEPENSSRNNRNSLYIDRLRSRIRLMYTHFRNDKTRKIWEQ
I

Enzyme Prediction     

No EC number prediction in MGYG000000852_00709.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.70e-12	14	151	1	126	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	6.17e-12	13	115	1	108	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.13e-10	10	287	3	289	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
COG1216	GT2	5.48e-09	10	290	3	266	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.43e-08	13	209	1	180	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE82244.1	3.47e-118	10	299	4	292
QVJ82014.1	3.47e-118	10	299	4	292
QUB77303.1	1.46e-115	10	299	7	295
QUB81500.1	5.93e-115	10	299	7	295
AUI55306.1	1.19e-114	10	299	7	295

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000852_00709.