CAZyme Information: MGYG000000852_01275

Basic Information

• Species: Prevotella sp900545525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900545525
• CAZyme ID: MGYG000000852_01275
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		43382	7.8266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000852	2918004	MAG	China	Asia

• Gene Location: Start: 84602; End: 85726 Strand: +

Full Sequence      

MKRILLFCVSLACTLYICAQEDAAGRTYKEKRSSKEWSRIARAETDGFFSTSEARRIGDN
VLLYQYDNGGWAKNIYMPAELTEAEKEELRRNKGYLEDTTIDNNATMTEIIFLARLYNAT
GEKRYGEGVRCGVEYLLESQYDNGGWPQFYPRNHGYYTHITYNDNAMENVLRVLYDVSRG
KKLYKFLPEEMRRRAAEAVDKGVDCILRTQVVQGGVPTVWCAQHDEHTLLPAKARAYELE
SLSGAESAGVVLFLMSMKERPSEAVVKAVDNAVEWFRKSMITDLKRENFTDGEGRRDYRM
VKSIGKDAACDTLWARFYTLEDNRPFFCDRDGVRKYDVSEIGYERRNHYSWYTDQPKKVL
ARYEKWRKTVGGKD

Enzyme Prediction     

No EC number prediction in MGYG000000852_01275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	65	359	4.9e-114	0.9965277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	4.67e-145	65	360	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	3.26e-133	65	360	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48738.1	1.05e-151	1	371	1	367
QUT45489.1	1.05e-151	1	371	1	367
QUT93421.1	4.16e-148	1	368	1	360
ALJ61046.1	4.16e-148	1	368	1	360
AVM57574.1	9.96e-148	1	373	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.88e-68	48	368	77	406	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	9.14e-62	59	351	38	314	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.42e-60	59	351	38	314	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001681	0.757200	0.240308	0.000265	0.000250	0.000260

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000852_01275.