CAZyme Information: MGYG000000852_01624

Basic Information

• Species: Prevotella sp900545525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900545525
• CAZyme ID: MGYG000000852_01624
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000000852_18|CGC1	66597.72	5.2891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000852	2918004	MAG	China	Asia

• Gene Location: Start: 34710; End: 36533 Strand: +

Full Sequence      

MKQFFILVAAMLCCGMPLRAGDIHVSASSGDDKAAGTEAAPLRTVGQALKQAREWRRLNL
PQAEGGINIILGDGIYRQTTPLFVRPEDSGTPQSPTTVRAAHAGKAVISGGMEVTGWTRG
CDDTRLPAHVRNKVWVAEAPRLGNRIVETRQMYVDGVKARRASQFAEGVMERMKDFNAAD
ETITIPTPETDLKSATQLEMVVHQRWAIAILRVKSMTDDGNGNTVVRFHDPESRLEFAHP
WPQPVIGGERGNSSFFFTNALELLDEPGEWYQDYPSGRIYYYPKDERDMNGKSVVVPVTE
TLLAVEGTRERTVGNICFEDVAFEHASWLRPSHEGHVTLQGGFRLIDAYKLDIPGLPEKK
ELENQAWIARPEAAVTVRHAHDIDFRGCIFRHLAATGLDYVTAVSSSGVSHCTFGDIGGT
ALQIGTFPDGGFETHVPYIPAVKEDICSGIMVKGNVIRDATNEDWGCVGIGAGYVRDVTI
EGNEVSNLNYSGICVGWGWTALESGMRNNRIVGNHVHDFARQLYDAGGIYTLSNQPGSVI
SGNRIDNLADAPYATNSRAFYIYFDEATDGFTVENNRCPDAEFGYNRPGPSLVVRNNGPE
VKLSEGD

Enzyme Prediction     

No EC number prediction in MGYG000000852_01624.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	24	580	5.9e-191	0.9886148007590133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.81e-09	374	543	25	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	4.25e-09	447	604	8	130	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.77e-08	373	576	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	3.20e-06	368	543	37	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	5.62e-05	449	576	65	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	0.0	1	603	1	604
AII69040.1	3.57e-299	1	604	1	603
QUT84057.1	3.57e-299	1	604	1	603
QJR76527.1	3.90e-299	1	604	1	603
ALA74807.1	1.10e-298	1	604	32	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	7.35e-159	18	601	22	605	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000763	0.711965	0.286508	0.000284	0.000255	0.000223

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000852_01624.