CAZyme Information: MGYG000000852_02257

Basic Information

• Species: Prevotella sp900545525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900545525
• CAZyme ID: MGYG000000852_02257
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36666.58	7.5266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000852	2918004	MAG	China	Asia

• Gene Location: Start: 9044; End: 10021 Strand: +

Full Sequence      

MKKFFTIIAALMCTVTMNAANPYDNPDTLVVSRDGTGEFRTIDDAVEVCRAFMDYHKVIY
VKKGVYKEKLIIPSWLTNIEICGEDAENTIITYDDHANIRIPGTDRKMGTFRTYTVKVEG
NDITFKNITIENNAARLGQAVALHTEGDRLVFVNCRFLGNQDTIYTGVGGTRLYFKNCYI
EGTTDFIFGPSTAWFEGCTIYSKINSYVTAASTPADIAYGYVFNNCRLISAPTADKVYLG
RPWRPYAYTLFMNCDLGRHIVPQGWHNWGKASNEQTARYCEYNNRGEGAATAQRAAWSRQ
LTKKEAAKITLAEVFKYDSSWIPAE

Enzyme Prediction     

No EC number prediction in MGYG000000852_02257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	315	8.9e-101	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	7.63e-78	29	308	7	289	pectinesterase
pfam01095	Pectinesterase	2.03e-74	30	313	3	293	Pectinesterase.
COG4677	PemB	9.10e-66	26	316	80	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.02e-65	28	323	70	368	pectinesterase family protein
PLN02432	PLN02432	4.90e-64	29	307	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	1.65e-172	1	323	1	322
ADE82952.1	1.65e-172	1	323	1	322
BCS84477.1	1.36e-167	1	324	1	324
QJR97878.1	8.67e-167	23	323	16	318
AGB28242.1	4.42e-161	1	325	1	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	4.27e-33	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	4.46e-33	30	322	6	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.65e-33	29	324	9	310	Pectinmethylesterase from Carrot [Daucus carota]
5C1C_A	2.26e-32	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.85e-26	32	323	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.67e-51	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q5MFV6	1.90e-50	28	322	276	577	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
P41510	1.30e-49	28	322	272	573	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	1.50e-47	28	322	259	560	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV8	1.47e-45	28	297	283	559	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999090	0.000190	0.000158	0.000150	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000852_02257.