CAZyme Information: MGYG000000853_00513

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_00513
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45158.44	8.5171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 17252; End: 18478 Strand: +

Full Sequence      

MKTKSNACRLQVLAVVLAAVAAACAVSSCGGKQAERVEAPWGVVNDSAGSADGFDLDRIQ
ANGEMIMLALGGPESYYDYRGRHLGLQYMLCQRFADHIGVSLRVEVCRDTAEMLRRLAAD
DGDVAACFVADAEVAAAAASEPRLVSCAVGVDSAAAHWVLTSAKPRLAEAIDGWYRPGMI
DAVRREEALLLSSASVKRRVYSPMLNRKEGIISRYDALFMTYSQPIRWDWRLMAAQCYQE
STFDPAARSWAGACGLMQIMPSTAVQLGLPADGLFDPESNIAAAARFLGQLERKFSDIAD
RGERLRFVLASYNGGYHHIRDAMALAGRDGHNQHRWADVSRYVLLLSTPRYYQDPIVKYG
YMRGSETVDYVQKIYRRWESYRGVKGGHDGFTGTTPRKATHRKKKYEI

Enzyme Prediction     

No EC number prediction in MGYG000000853_00513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	226	379	1.6e-29	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	5.31e-72	219	382	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	4.03e-48	56	377	36	445	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	2.29e-44	55	383	15	433	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	1.50e-22	239	382	30	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.12e-21	229	327	11	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	4.46e-138	28	402	17	386
QUB48180.1	2.14e-136	26	408	16	390
ADE82116.1	1.04e-135	28	408	19	375
QVJ81630.1	1.20e-134	28	408	19	375
QNT65891.1	1.84e-131	27	394	17	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	9.65e-24	56	379	11	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	1.05e-22	56	379	4	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.11e-22	56	379	11	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	5.68e-22	212	379	249	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	5.68e-22	212	379	249	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	6.87e-28	56	389	35	455	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A8ZWR8	1.26e-27	228	374	299	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q6LU25	2.93e-27	209	388	287	460	Membrane-bound lytic murein transglycosylase F OS=Photobacterium profundum (strain SS9) OX=298386 GN=mltF PE=3 SV=1
Q2NS21	4.93e-27	55	379	35	447	Membrane-bound lytic murein transglycosylase F OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltF PE=3 SV=1
A3QCH2	6.41e-26	194	380	256	439	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000282	0.999748	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31