CAZyme Information: MGYG000000853_00598

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_00598
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		90662.57	7.2828

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 12115; End: 14508 Strand: +

Full Sequence      

MRKRMFFVHLALLACSAGVSQSRLYPRLFDLTDVELTDGAFKRAMMLNDSVLLAYDAGRL
MQPFEHQAGIEESGTAFRNWTGLDGHVGGHYITALAVSYASCRDEAVKRQLGERLDWCLG
RLKAVQDKWNVDADNRMHGYIGGVPGSREFFTRYASGEVDVVWKWWVPFYNVHKIFAGLR
DAWLYAGREDAREMFIGLCDWGVNIIGGLTDEQIEASLNQEYGGMNEVFADAYQMTGDMK
YLEAARKFSHKWLLNGMAAHNASTLDNRHANTQVPKVVGFERVYQQDHASEYGEAARFFW
SDVVGERTIAVGGNSINEWFPTKKKYADFITSIEGVESCNSYNMLKLSEDLFLSDGDSRY
VDFYEGTLFNHILSTQHPRTGGYVYFTPARPQHYRVYSQVNEAMWCCVGSGMENHGKYGE
FVYSHSVGNDSLWVNLFIASRLDWKKRKTVVEQTTMFPYEQSTELKVNGKGSFTLLVRIP
EWTDGKFSMTVNGKKADYATCRGYAAITRKWKRGDVVKVALPMNIRVEPLNNYTDYVAFK
YGPILLGARTGQDNLRGLHADDSRMGHIASGERKNIYTAPMLIGERSRLADALKLVDKEK
LIFRIEGYDVHNGGGAPLLLQPFNTIHDSRYMMYWLNVTKEKWARMQAESKAREDSIQAL
EARTVDYVVTGTQQSEADHFMQQEGTRQGAFNDEYYRQAEDGHFTYRMNPGTEGDESPKS
LMLRYWGRDRGMVEASIDGNIVCVLDAKGDCDGFINVEYPLNPDFIKGKKRVEVRLSSKG
KGLRVYYLRITKTALTK

Enzyme Prediction     

No EC number prediction in MGYG000000853_00598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	546	5e-175	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.59e-136	33	546	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.14e-87	34	553	12	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.01e-27	551	635	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCV06553.1	1.46e-248	15	778	14	781
QRQ58640.1	1.46e-248	15	778	14	781
ALJ47143.1	1.46e-248	15	778	14	781
QUT25628.1	1.46e-248	15	778	14	781
QCD36520.1	2.63e-246	12	778	14	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	7.98e-197	7	761	6	771	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.01e-191	7	761	6	771	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	3.61e-22	169	560	142	557	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	6.86e-15	231	545	250	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	8.22e-09	294	528	295	541	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.50e-08	294	528	295	541	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002099	0.379773	0.617307	0.000256	0.000318	0.000237

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000853_00598.