CAZyme Information: MGYG000000853_00675

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_00675
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		75095.07	8.2199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 9823; End: 11859 Strand: +

Full Sequence      

MMKKSILSIAMLLTASGVMGQKQSYGYPYTPVAFTSVKIAPNTFWGDRIKAARETTIPLA
FSKCESEGRYSNFVKAAHPSDDYDVKTFMGFSFDDTDVYKTIEGASYLLQTYPDKRMEQY
IDSVLDIVAAAQEKDGYLYTARTINPKKPHPWAGTRRWEAVENLSHELYNLGHMVDAACA
HYQATGSTKFLDIAKRYADCVIREVGAGEGQAHVVPGHQIAEMALARMYVLTGDKRYLDE
AKFFLDMRGKTQRKNAYSQSHKPVTEQDEAVGHAVRAGYMYSGMADVAALTGDSSYIRAI
DRICDNIIGKKYYLTGGVGARHAGEAFGSNYELPNLTAYNETCAAISMVYLFQRMFLFRG
ESKYIDCLERTLYNGVISGMSVDGGRFFYPNPLASDGKYAFNADGNTTRQPWFGCACCPS
NLSRFIPSLPGYVYAVKDDNLYVNLFAANTATVRVAGKDVTLSQDTRYPWDGDIAISILK
NKGKAFTMKVRIPGWVRGQVVPSDLYSYADDVKTGYTVTVNGEKTDGRLTPDGYLTIARQ
WKKGDVVRVHFDMLPRVVTANAKVTDDRGKIAVERGPLVYCAEQADNTGFNTHHVLLSRK
PQFAVSAGYGIKNTENGGQTFNVTSITVDNAQCATIDGDGTLTAKNVKLTLIPYYAWNHR
GAGRMDVWMARNLDGLGE

Enzyme Prediction     

No EC number prediction in MGYG000000853_00675.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	42	581	1.8e-203	0.9904580152671756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	36	581	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.56e-164	31	671	11	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	6.46e-04	182	303	99	230	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04791	LanC_SerThrkinase	0.004	180	307	154	278	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04792	LanM-like	0.008	168	303	552	679	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67047.1	0.0	6	676	9	689
BCS84603.1	0.0	26	673	13	658
QUT33914.1	0.0	4	672	2	658
QUU00384.1	0.0	4	672	2	658
BBK85668.1	0.0	4	672	2	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	8.81e-314	24	669	2	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.45e-134	38	669	11	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.98e-129	38	669	11	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.22e-115	54	671	34	658	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.65e-115	54	671	34	658	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.70e-115	54	671	34	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002181	0.963608	0.033221	0.000394	0.000299	0.000263

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000853_00675.