CAZyme Information: MGYG000000853_01334

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_01334
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000000853_59|CGC1	94964.82	6.595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 15478; End: 17982 Strand: +

Full Sequence      

MSRIILLANVLWLLGMFCPLALSAAEPFVTFSAGEGAQCITGANISFDRNEYPGVLTAIT
NLQDDFERVTGRRPAADGGGRAADILIGTVGRSKAIDRLLKKGLLPELKGRREKYVITVA
DGRLVIAGSDKRGTIYGIYELSRQMGVSPWYYWADVPVVHHDEVYVRPGVYTDGEPKVRY
RGLFLNDEAPCLTGWAGKTFGGFNHKFYEKVFELILRMKGNFIWPAMWGSAFYDDDPENG
PTADRMGVMVGLSHHEPMSRSQAEWHRTEGSKVWDYTKNKEKLQDFWAGGVRRNRNTEDV
VTVGMRGDGDEAMSEDTNVELLQRIVDDQRAIIARERKCKAEEVPQVWALYKEVQDYYHN
GMRVPDDVTLLLCDNNWGSLRMLPSPDEPKRKGGYGIYYHYDYVGGPRCYRWLNVSQIQR
VWADMNMAYENGVNRLWIVNVGDLKPMEFPTQFWFDMAWNPERFNAGNLFEYTVDYCRAT
FGQRYAEEAARLLNLACKYAHRRTPELMNKLPYSVENYDEFRRVTADYNSLEADAERLYR
LLEPQYRDAFMQIVRYPVMAMANLYRMYYASATGDSVATRHWFDRDAALTKYYNDTLCGG
KWKHMMDQTHISYTSWASPKVDVMPEIKSVPSAGCNAGKCPEATCCEKWVKGVVSIEAPH
YYEAKAADGVSWTFIPDYGKTMGALTLLPTNRPVEGSEVTYRFRADGDYDKATLHCLFAP
MLDYTGGDGIWYEVSVDGGSPQKVNLIASAMSDRERDRLLRNMPEGHFDQNRIIDSRTVL
TAAFRKGHEHTVTLRPLSRGILLEKLIVDFGGMKPSYLGTPETPFAVIPGFRHD

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	42	806	6.2e-254	0.9827833572453372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	174	507	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.61e-36	652	822	7	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	3.03e-09	50	141	28	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
pfam02838	Glyco_hydro_20b	5.88e-04	62	145	40	107	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3533	COG3533	5.94e-04	441	568	108	244	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55455.1	8.21e-295	44	823	49	831
QIK60872.1	8.21e-295	44	823	49	831
CDT30889.1	1.64e-286	23	823	51	857
VTR27629.1	1.68e-284	48	823	80	857
QDO71564.1	1.04e-280	21	823	5	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	2.20e-246	20	823	26	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.88e-227	41	824	24	835	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	9.29e-225	41	824	23	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.38e-184	28	824	5	934	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.34e-118	41	616	18	645	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.999082	0.000170	0.000146	0.000134	0.000135

TMHMM  Annotations     

start	end
5	24